Allele Report for B*13:07N

B*13:07N View HGVS Report
Pre-2010 Nomenclature: B*1307N Local Names: HLAB1301V1
IMGT/HLA Acc No: HLA01309 OMIM Entry: *142830
Assigned: 2000-08-31 Sequence Last Modified: 2002-07-15
Source Entries: AB032598  
Cells Sequence Derived From: JCB13747  
Known Ethnic Origin Of Source: Oriental
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: Not expressed WHO Assigned Type: Null
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) - -
Neural Network Assigned Type: Not tested
Comments:
Protein Sequence (176 aa)
SHSMRYFYTAMSRPGRGEPRFITVGYVDDTQFVRFDSDATSPRMAPRAPWIEQEGPEYWVSKTNTQTYRENLRTALRYYN
QSEAGSHIIQRMYGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQLKWEAARVAEQLRAYLEGECVE
WLRRYLENGKETLQRA
Nucleotide Sequence Data (531 bps)
GCTCCCACTCCATGAGGTATTTCTACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCACCGTGGGCTAC
GTGGACGACACCCAGTTCGTGAGGTTCGACAGCGACGCCACGAGTCCGAGGATGGCGCCCCGGGCGCCATGGATAGAGCA
GGAGGGGCCGGAGTATTGGGTCTCCAAGACCAACACACAGACTTACCGAGAGAACCTGCGCACCGCGCTCCGCTACTACA
ACCAGAGCGAGGCCGGGTCTCACATCATCCAGAGGATGTATGGCTGCGACCTGGGGCCGGACGGGCGCCTCCTCCGCGGG
CATAACCAGTTAGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGACCGCGGCGGACACCGC
GGCTCAGATCACCCAGCTCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGCTGAGAGCCTACCTGGAGGGCGAGTGCGTGG
AGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo