Allele Report for B*13:01:01

B*13:01:01
Pre-2010 Nomenclature: B*130101 Local Names: B13.1
IMGT/HLA Acc No: HLA00152 OMIM Entry: *142830
Assigned: 1989-08-01 Sequence Last Modified: 1998-12-16
Source Entries: D50290 , FJ973631 , HM484300 , HM543706 , M24075  
Cells Sequence Derived From: 7550801705 , HE , P3869 , SDI , SZ-74 , TAC , YTY  
Known Ethnic Origin Of Source: Oriental
Publications
Cheng LH et al. Tissue Antigens 74:544-546 2009. (View abstract)
Lin L et al. Hum Immunol 43:51-6 1995. (View abstract)
Kato K et al. Immunogenetics 29:117-20 1989. (View abstract)
Zhu F et al. Int J Immunogenet 38:281-284 2011. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 7 Laboratories: 5
HLA Dictionary Data
Expert Assigned Type: B13 WHO Assigned Type: B13
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 4 B13 [95-99%]
NMDP (2008) 238 B13 [97%]
13 IHWC (2002) 9 B13
Neural Network Assigned Type: Training - B13
Comments:
Protein Sequence (362 aa)
MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPRFITVGYVDDTQFVRFDSDATSPRMAPRAPWIEQEG
PEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAA
DTAAQITQLKWEAARVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAV
VVIGAVVAAVMCRRKSSGGKGGSYSQAACSDSAQGSDVSLTA
Nucleotide Sequence Data (1089 bps)
ATGCGGGTCACGGCGCCCCGAACCCTCCTCCTGCTGCTCTGGGGGGCAGTGGCCCTGACCGAGACCTGGGCCGGCTCCCA
CTCCATGAGGTATTTCTACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCACCGTGGGCTACGTGGACG
ACACCCAGTTCGTGAGGTTCGACAGCGACGCCACGAGTCCGAGGATGGCGCCCCGGGCGCCATGGATAGAGCAGGAGGGG
CCGGAGTATTGGGACCGGGAGACACAGATCTCCAAGACCAACACACAGACTTACCGAGAGAACCTGCGCACCGCGCTCCG
CTACTACAACCAGAGCGAGGCCGGGTCTCACATCATCCAGAGGATGTATGGCTGCGACCTGGGGCCGGACGGGCGCCTCC
TCCGCGGGCATAACCAGTTAGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGAGCTCCTGGACCGCGGCG
GACACCGCGGCTCAGATCACCCAGCTCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGCTGAGAGCCTACCTGGAGGGCGA
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGACCCCCCAAAGACACACGTGA
CCCACCACCCCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGCGAGGACCAAACTCAGGACACTGAGCTTGTGGAGACCAGACCAGCAGGAGATAGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACATGCCATGTACAGCATGAGGGGCTGCCGAAGCCCC
TCACCCTGAGATGGGAGCCATCTTCCCAGTCCACCGTCCCCATCGTGGGCATTGTTGCTGGCCTGGCTGTCCTAGCAGTT
GTGGTCATCGGAGCTGTGGTCGCTGCTGTGATGTGTAGGAGGAAGAGCTCAGGTGGAAAAGGAGGGAGCTACTCTCAGGC
TGCGTGCAGCGACAGTGCCCAGGGCTCTGATGTGTCTCTCACAGCTTGA
Genomic Sequence Data (3324 bps)
GATCAGGACGAAGTCCCAGGTCCCGGACGGGGCTCTCAGGGTCTCAGGCTCCGAGAGCCTTGTCTGCATTGGGGAGGCGC
AGCGTTGGGGATTCCCCACTCCCACGAGTTTCACTTCTTCTCCCAACCTATGTCGGGTCCTTCTTCCAGGATACTCGTGA
CGCGTCCCCAATTCCCACTCCCATTGGGTGTCGGGTGTCTAGAGAAGCCAATCAGTGTCGCCGGGGTCCCAGTTCTAAAG
TCCCCACGCACCCACCCGGACTCAGAATCTCCTCAGACGCCGAGATGCGGGTCACGGCGCCCCGAACCCTCCTCCTGCTG
CTCTGGGGGGCAGTGGCCCTGACCGAGACCTGGGCCGGTGAGTGCGGGATCGGGAGGGAAATGGCCTCTGTGGGGAGGAG
CGAGGGGACCGCAGGCGGGGGCGCAGGACCCGGGGAGCCGCGCCGGGAGGAGGGTCTGGCGGGTCTCAGCCCCTCCTGGC
CCCCAGGCTCCCACTCCATGAGGTATTTCTACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCACCGTG
GGCTACGTGGACGACACCCAGTTCGTGAGGTTCGACAGCGACGCCACGAGTCCGAGGATGGCGCCCCGGGCGCCATGGAT
AGAGCAGGAGGGGCCGGAGTATTGGGACCGGGAGACACAGATCTCCAAGACCAACACACAGACTTACCGAGAGAACCTGC
GCACCGCGCTCCGCTACTACAACCAGAGCGAGGCCGGTGAGTGACCCCGGCCCGGGGCGCAGGTCACGACTCCCCATCCC
CCACGGACGGCCCGGGTCGCCCCGAGTCTCCGGGTCCGAGATCCGCCTCCCTGAGGCCGCGGGACCCGCCCAGACCCTCG
ACCGGCGAGAGCCCCAGGCGCGTTTACCCGGTTTCATTTTCAGTTGAGGCCAAAATCCCCGCGGGTTGGTCGGGGCGGGG
CGGGGCTCGGGGGACGGGGCTGACCGCGGGGCCGGGGCCAGGGTCTCACATCATCCAGAGGATGTATGGCTGCGACCTGG
GGCCGGACGGGCGCCTCCTCCGCGGGCATAACCAGTTAGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTG
AGCTCCTGGACCGCGGCGGACACCGCGGCTCAGATCACCCAGCTCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGCTGAG
AGCCTACCTGGAGGGCGAGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCGCGGGTA
CCAGGGGCAGTGGGGAGCCTTCCCCATCTCCTATAGGTCGCCGGGGATGGCCTCCCACGAGAAGAGGAGGAAAATGGGAT
CAGCGCTAGAATGTCGCCCTCCCTTGAATGGAGAATGGCATGAGTTTTCCTGAGTTTCCTCTGAGGGCCCCCTCTTCTCT
CTAGGACAATTAAGGGATGACGTCTCTGAGGAAATGTAGGGGAAGACAGTCCCTAGAATACTGATCAGGGGTCCCCTTTG
ACCCCTGCAGCAGCCTTGGGAACCGTGACTTTTCCTCTCAGGCCTTGTTCTCTGCCTCACACTCAGTGTGTTTGGGGCTC
TGATTCCAGCACTTCTGAGTCACTTTACCTCCACTCAGATCAGGAGCAGAAGTCCCTGTTCCCCGCTCAGAGACTCGAAC
TTTCCAATGAATAGGAGATTATCCCAGGTGCCTGCGTCCAGGCTGGTGTCTGGGTTCTGTGCCCCTTCCCCACCCCAGGT
GTCCTGTCCATTCTCAGGCTGGTCACATGGGTGGTCCTAGGGTGTCCCATGAGAGATGCAAAGCGCCTGAATTTTCTGAC
TCTTCCCATCAGACCCCCCAAAGACACACGTGACCCACCACCCCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCC
CTGGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGATGGCGAGGACCAAACTCAGGACACTGAGCTTGTGGA
GACCAGACCAGCAGGAGATAGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACAT
GCCATGTACAGCATGAGGGGCTGCCGAAGCCCCTCACCCTGAGATGGGGTAAGGAGGGGGATGAGGGGTCATATCTCTTC
TCAGGGAAAGCAGGAGCCCTTCTGGAGCCCTTCAGCAGGGTCAGGGCCCCTCATCTTCCCCTCCTTTCCCAGAGCCATCT
TCCCAGTCCACCGTCCCCATCGTGGGCATTGTTGCTGGCCTGGCTGTCCTAGCAGTTGTGGTCATCGGAGCTGTGGTCGC
TGCTGTGATGTGTAGGAGGAAGAGCTCAGGTAGGGAAGGGGTGAGGGGTGGGGTCTGGGTTTTCTTGTCCCACTGGGGGT
TTCAAGCCCCAGGTAGAAGTGTTCCCTGCCTCATTACTGGGAAGCAGCATGCACACAGGGGCTAACGCAGACTGGGACCC
TGTGTGCCAGCACTTACTCTTTTGTGCAGCACATGTGACAATGAAGCACGGATGTATCACCTTGATGGTTGTGGTGTTGG
GGTCCTGATTCCAGCATTCATGAGTCAGGGGAAGGTCCCTGCTAAGGACAGACCTTAGGAGGGCAGTTGGTCCAGGACCC
ACACTTGCTTTCCTCGTGTTTCCTGATCCTGCCCTGGGTCTGTAGTCATACTTCTGGAAATTCCTTTTGGGTCCAAGACT
AGGAGGTTCCTCTAAGATCTCATGGCCCTGCTTCCTCCCAGTCCCCTCACAGGACATTTTCTTCCCACAGGTGGAAAAGG
AGGGAGCTACTCTCAGGCTGCGTGTAAGTGGTGGGGGTGGGAGTGTGGAGGAGCTCACCCACCCCATAATTCCTCCTGTC
CCACGTCTCCTGCGGGCTCTGACCAGGTCCTGTTTTTGTTCTACTCCAGGCAGCGACAGTGCCCAGGGCTCTGATGTGTC
TCTCACAGCTTGAAAAGGTGAGATTCTTGGGGTCTAGAGTGGGCGGGGGGGGTGGTGGGGCAGAGGGGAAAGGCCTGGGT
AATGGACATTCTTTGATTGGGATGTTTCGCGTGTGTGGTGGGCTGTTTAGAGTGTCATCACTTACCATGACTAACCAGAA
TTTGTTCATGACTGTTGTTTTCTGTAGCCTGAGACAGCTGTCTTGTGAGGGACTGAGATGCAGGATTTCTTCACGCCTCC
CCTTTGTGACTTCAAGAGCCTCTGGCATCTCTTTCTGCAAAGGCACCTGAATGTGTCTGTGTCCCTGTTAGCATAATGTG
AGGAGGTGGAGAGACAGCCCAACTGTGTGTCCACTGTGACCCCT

IMGT/HLA

Sponsors

Animated Sponsors Logo