Allele Report for B*08:09

B*08:09 View HGVS Report
Pre-2010 Nomenclature: B*0809 Local Names: B*08Ho, B*MW, B*08New, HM-ARCBS
IMGT/HLA Acc No: HLA00976 OMIM Entry: *142830
Assigned: 1999-03-25 Sequence Last Modified: 2004-01-16
Source Entries: AF102559 , AF102560 , AF117768 , AF117769 , AF127247 , AF127248 , AF176073 , AF176074 , AH007564 , AH007613 , AH007717 , AH008124 , AJ131852 , AJ131853 , AJ276994 , AJ607425  
Cells Sequence Derived From: ANO , GN00244 , GN00287 , H.O. , HM-ARCBS , MW-ARCBS  
Known Ethnic Origin Of Source: Black, Caucasoid
Publications
Steiner NK et al. Tissue Antigens 57:373-5 2001. (View abstract)
Elsner HA et al. Tissue Antigens 55:74-7 2000. (View abstract)
Anholts JD et al. Tissue Antigens 58:38-41 2001. (View abstract)
Kennedy CT et al. Tissue Antigens 55:266-70 2000. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 6 Laboratories: 6
HLA Dictionary Data
Expert Assigned Type: B8 WHO Assigned Type: B8
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) 11 B8 [100%]
13 IHWC (2002) 2 B8
Neural Network Assigned Type: B8
Comments:
Protein Sequence (273 aa)
SHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNL
RGYYNQSEAGSHTWQTMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLE
GTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTF
QKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Nucleotide Sequence Data (822 bps)
GCTCCCACTCCATGAGGTATTTCGACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGAGAGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCGGAACACACAGATCTTCAAGACCAACACACAGACTGACCGAGAGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACTTGGCAGACGATGTATGGCTGCGACGTGGGGCCGGACGGG
CGCCTCCTCCGCGGGCATAACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGAC
CGCGGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGGACAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGACACGCTGGAGCGCGCGGACCCCCCAAAGACA
CACGTGACCCACCACCCCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCAC
ACTGACCTGGCAGCGGGATGGCGAGGACCAAACTCAGGACACTGAGCTTGTGGAGACCAGACCAGCAGGAGATAGAACCT
TCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACATGCCATGTACAGCATGAGGGGCTGCCG
AAGCCCCTCACCCTGAGATGGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo