Allele Report for B*08:08N

B*08:08N View HGVS Report
Pre-2010 Nomenclature: B*0808N Local Names: B*08Null
IMGT/HLA Acc No: HLA00975 OMIM Entry: *142830
Assigned: 1999-01-06 Sequence Last Modified: 1999-04-08
Source Entries: Y18552  
Cells Sequence Derived From: RS , STRIJOHN  
Known Ethnic Origin Of Source: Caucasoid
Publications
Carter V et al. Tissue Antigens 55:61-4 2000. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 2 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: Not expressed WHO Assigned Type: Null
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) - -
Neural Network Assigned Type: Not tested
Comments:
Protein Sequence (213 aa)
MLVMAPRTVLLLLSAALALTETWAGSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEG
PEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTRR
TPRLRSPSASGRRPVWRSRTEPTWRARAWSGSADTWRTGRTRWSARTPQRHTX
Nucleotide Sequence Data (1088 bps)
ATGCTGGTCATGGCGCCCCGAACCGTCCTCCTGCTGCTCTCGGCGGCCCTGGCCCTGACCGAGACCTGGGCCGGCTCCCA
CTCCATGAGGTATTTCGACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGAGAGGAGCCGCGGGCGCCGTGGATAGAGCAGGAGGGG
CCGGAGTATTGGGACCGGAACACACAGATCTTCAAGACCAACACACAGACTGACCGAGAGAGCCTGCGGAACCTGCGCGG
CTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGCATGTACGGCTGCGACGTGGGGCCGGACGGGCGCCTCC
TCCGCGGGCATAACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGACGCGGCGG
ACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGGACAGAGCCTACCTGGAGGGCACG
TGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGACACGCTGGAGCGCGCGGACCCCCCAAAGACACACGTGAC
CCACCACCCCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACCT
GGCAGCGGGATGGCGAGGACCAAACTCAGGACACTGAGCTTGTGGAGACCAGACCAGCAGGAGATAGAACCTTCCAGAAG
TGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACATGCCATGTACAGCATGAGGGGCTGCCGAAGCCCCT
CACCCTGAGATGGGAGCCGTCTTCCCAGTCCACCGTCCCCATCGTGGGCATTGTTGCTGGCCTGGCTGTCCTAGCAGTTG
TGGTCATCGGAGCTGTGGTCGCTGCTGTGATGTGTAGGAGGAAGAGCTCAGGTGGAAAAGGAGGGAGCTACTCTCAGGCT
GCGTGCAGCGACAGTGCCCAGGGCTCTGATGTGTCTCTCACAGCTTGA
Genomic Sequence Data (3035 bps)
ATGCTGGTCATGGCGCCCCGAACCGTCCTCCTGCTGCTCTCGGCGGCCCTGGCCCTGACCGAGACCTGGGCCGGTGAGTG
CGGGTCGGGAGGGAAATGGCCTCTGCCGGGAGGAGCGAGGGGACCGCAGGCGGGGGCGCAGGACCTGAGGAGCCGCGCCG
GGAGGAGGGTCGGGCGGGTCTCAGCCCCTCCTCGCCCCCAGGCTCCCACTCCATGAGGTATTTCGACACCGCCATGTCCC
GGCCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGGGCTACGTGGACGACACGCAGTTCGTGAGGTTCGACAGCGACGCC
GCGAGTCCGAGAGAGGAGCCGCGGGCGCCGTGGATAGAGCAGGAGGGGCCGGAGTATTGGGACCGGAACACACAGATCTT
CAAGACCAACACACAGACTGACCGAGAGAGCCTGCGGAACCTGCGCGGCTACTACAACCAGAGCGAGGCCGGTGAGTGAC
CCCGGCCCGGGGCGCAGGTCACGACTCCCCATCCCCCACGGACGGCCCGGGTCGCCCCGAGTCTCCGGGTCCGAGATCCG
CCTCCCTGAGGCCGCGGGACCCGCCCAGACCCTCGACCGGCGAGAGCCCCAGGCGCGTTTACCCGGTTTCATTTTCAGTT
GAGGCCAAAATCCCCGCGGGTTGGTCGGGGCGGGGCGGGGCTCGGGGGGACGGGGCTGACCGCGGGGCCGGGGCCAGGGT
CTCACACCCTCCAGAGCATGTACGGCTGCGACGTGGGGCCGGACGGGCGCCTCCTCCGCGGGCATAACCAGTACGCCTAC
GACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGACGCGGCGGACACCGCGGCTCAGATCACCCAGCGC
AAGTGGGAGGCGGCCCGTGTGGCGGAGCAGGACAGAGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCAGATACCT
GGAGAACGGGAAGGACACGCTGGAGCGCGCGGGTACCAGGGGCAGTGGGGAGCCTTCCCCATCTCCTATAGGTCGCCGGG
GATGGCCTCCCACGAGAAGAGGAGGAAAATGGGATCAGCGCTAGAATGTCGCCCTCCCTTGAATGGAGAATGGCATGAGT
TTTCCTGAGTTTCCTCTGAGGGCCCCCTCTTCTCTCTAGACAATTAAGGGATGACGTCTCTGAGGAAATGGAGGGGAAGA
CAGTCCCTAGAATACTGATCAGGGGTCCCCTTTGACCCCTGCAGCAGCCTTGGGAACCGTGACTTTTCCTCTCAGGCCTT
GTTCTCTGCCTCACACTCAGTGTGTTTGGGGCTCTGATTCCAGCACTTCTGAGTCACTTTACCTCCACTCAGATCAGGAG
CAGAAGTCCCTGTTCCCCGCTCAGAGACTCGAACTTTCCAATGAATAGGAGATTATCCCAGGTGCCTGCATCCGCTGGTG
TCTGGGTTCTGTGCCCCTTCCCCACCCCAGGTGTCCTGTCCATTCTCAGGCTGGTCACATGGGTGGTCCTAGGGTGTCCC
ATGAGAGATGCAAAGCGCCTGAATTTTCTGACTCTTCCCATCAGACCCCCCAAAGACACACGTGACCCACCACCCCATCT
CTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGATGGC
GAGGACCAAACTCAGGACACTGAGCTTGTGGAGACCAGACCAGCAGGAGATAGAACCTTCCAGAAGTGGGCAGCTGTGGT
GGTGCCTTCTGGAGAAGAGCAGAGATACACATGCCATGTACAGCATGAGGGGCTGCCGAAGCCCCTCACCCTGAGATGGG
GTAAGGAGGGGGATGAGGGGTCATATCTCTTCTCAGGGAAAGCAGGAGCCCTTCAGCAGGGTCAGGGCCCCTCATCTTCC
CCTCCTTTCCCAGAGCCGTCTTCCCAGTCCACCGTCCCCATCGTGGGCATTGTTGCTGGCCTGGCTGTCCTAGCAGTTGT
GGTCATCGGAGCTGTGGTCGCTGCTGTGATGTGTAGGAGGAAGAGCTCAGGTAGGGAAGGGGTGAGGGGTGGGGTCTGGG
TTTTCTTGTCCCACTGGGGGTTTCAAGCCCCAGGTAGAAGTGTTCCCTGCCTCATTACTGGGATGCAGCATCCACACAGG
GGCTAACGCAGCCTGGGACCCTGTGTGCCAGCACTTACTCTTTTGTGCAGCACATGTGACAATGAAGGACGGATGTATCA
CCTTGGTGGTTGTGGTGTTGGGGTCCTGATTCCAGCATTCATGAGTCAGGGGAAGGTCCCTGCTAAGGACAGACCTTAGG
AGGGCAGTTGGTCCAGGACCCACACTTGCTTTCCTCGTGTTTCCTGATCCTGCCTTGGGTCTGTAGTCATACTTCTGGAA
ATTCCTTTTGGGTCCAAGACGAGGAGGTTCCTCTAAGATCTCATGGCCCTGCTTCCTCCCAGTCCCCTCACAGGGCATTT
TCTTCCCACAGGTGGAAAAGGAGGGAGCTACTCTCAGGCTGCGTGTAAGTGATGGGGGTGGGAGTGTGGAGGAGCTCACC
CACCCCATAATTCCTCCTGTCCCACGTCTCCTGCGGGCTCTGACCAGGTCCTGTTTTTGTTCTACTCCAGGCAGCGACAG
TGCCCAGGGCTCTGATGTGTCTCTCACAGCTTGAAAAGGTGAGATTCTTGGGGTCTAGAGTGGGTGGGGTGGCGGGTCTG
GGGGTGGGTGGGGCAGTGGGGAAAGGCCTGGGTAATGGAGATTCTTTGATTGGGATGTTTCGCGTGTGTGGTGGGCTGTT
TAGAGTGTCATCACTTACCATGACTAACCAGAATTTGTTCATGACTGTTGTTTTCTGTAGCCTGAGACAGCTGTCTTGTG
AGGGACTGAGATGCAGGATTTCTTCACGCCTCCCCTTTGTGACTTCAAGAGCCTCTGGCATCTCTTTCTGCAAAGGCACC
TGAATGTGTCTGCGTCCCTGTTAGCATAATGTGAGGAGGTGGAGAGACAGCCCACCCTTGTGTCCACTGTGACCC

IMGT/HLA

Sponsors

Animated Sponsors Logo