Allele Report for B*08:01:08

B*08:01:08 View HGVS Report
Pre-2010 Nomenclature: B*080108 Local Names: HIS_NEW_B_273_00639, HIS_NEW_B_402_01257, HIS_NEW_B_421_01362
IMGT/HLA Acc No: HLA04210 OMIM Entry: *142830
Assigned: 2009-09-30 Sequence Last Modified: 2009-10-19
Source Entries: FJ538279 , FJ853792 , FJ875561 , FN430731 , GQ240393 , GQ245751 , GQ449633 , GQ900545 , GQ994057 , HM125835 , HM594777 , HQ154180 , JN123817 , JQ411827 , JQ668186 , JQ768450  
Cells Sequence Derived From: HG00001282 , HG00001283 , HG00001284 , HG00002000 , HG00002001 , HG00002401 , HG00004975 , HG00004976 , HG00004977 , HN-00172-4 , HN-12663-3 , HN-60847-6 , HN-69625-2 , HN-82787-0 , HN-82902-4 , P-664367  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Schlahsa L et al. Tissue Antigens 79:208-209 2012. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 16 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRNL
RGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARVAEQDRAYLE
GTCVEWLRRYLENGKDTLERA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCGACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGAGAGGAGCCCCGGGCGCCATGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCGGAACACACAGATCTTCAAGACCAACACACAGACTGACCGAGAGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGCATGTACGGCTGCGACGTGGGGCCGGACGGG
CGCCTCCTCCGCGGGCATAACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGAC
CGCGGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGGACAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGACACGCTGGAGCGCGCGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo