Allele Report for B*08:01:01

B*08:01:01
Pre-2010 Nomenclature: B*080101 Local Names: B8, B*0801
IMGT/HLA Acc No: HLA00146 OMIM Entry: *142830
Assigned: 1989-08-01 Sequence Last Modified: 1998-12-16
Source Entries: AJ295294 , AL669854 , D84394 , DQ249172 , DQ249174 , HG794374 , L76093 , M24036 , M28204 , M59841  
Cells Sequence Derived From: 12506397 , CGM1 , COX , HECO , LCL721 , MF , PAT135 , PAT144  
Known Ethnic Origin Of Source: Black, Caucasoid
Publications
Pohla H et al. Immunogenetics 29:297-307 1989. (View abstract)
Bronson SK et al. Proc Natl Acad Sci U S A 88:1676-80 1991. (View abstract)
Nair RP et al. Am J Hum Genet 78:827-51 2006. (View abstract)
Parham P et al. Proc Natl Acad Sci U S A 85:4005-9 1988. (View abstract)
Cox ST et al. Tissue Antigens 61:20-48 2003. (View abstract)
Stewart CA et al. Genome Res 14:1176-87 2004. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 8 Laboratories: 9
HLA Dictionary Data
Expert Assigned Type: B8 WHO Assigned Type: B8
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 9 B8 [100%]
NMDP (2008) 6518 B8 [99%]
13 IHWC (2002) 61 B8
Neural Network Assigned Type: Training - B8
Comments:
Protein Sequence (362 aa)
MLVMAPRTVLLLLSAALALTETWAGSHSMRYFDTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEG
PEYWDRNTQIFKTNTQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAA
DTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAV
VVIGAVVAAVMCRRKSSGGKGGSYSQAACSDSAQGSDVSLTA
Nucleotide Sequence Data (1089 bps)
ATGCTGGTCATGGCGCCCCGAACCGTCCTCCTGCTGCTCTCGGCGGCCCTGGCCCTGACCGAGACCTGGGCCGGCTCCCA
CTCCATGAGGTATTTCGACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGAGAGGAGCCGCGGGCGCCGTGGATAGAGCAGGAGGGG
CCGGAGTATTGGGACCGGAACACACAGATCTTCAAGACCAACACACAGACTGACCGAGAGAGCCTGCGGAACCTGCGCGG
CTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGCATGTACGGCTGCGACGTGGGGCCGGACGGGCGCCTCC
TCCGCGGGCATAACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGACCGCGGCG
GACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGGACAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGACACGCTGGAGCGCGCGGACCCCCCAAAGACACACGTGA
CCCACCACCCCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGCGAGGACCAAACTCAGGACACTGAGCTTGTGGAGACCAGACCAGCAGGAGATAGAACCTTCCAGAA
GTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACATGCCATGTACAGCATGAGGGGCTGCCGAAGCCCC
TCACCCTGAGATGGGAGCCGTCTTCCCAGTCCACCGTCCCCATCGTGGGCATTGTTGCTGGCCTGGCTGTCCTAGCAGTT
GTGGTCATCGGAGCTGTGGTCGCTGCTGTGATGTGTAGGAGGAAGAGCTCAGGTGGAAAAGGAGGGAGCTACTCTCAGGC
TGCGTGCAGCGACAGTGCCCAGGGCTCTGATGTGTCTCTCACAGCTTGA
Genomic Sequence Data (3322 bps)
GATCAGGACGAAGTCCCAGGTCCCGGACGGGGCTCTCAGGGTCTCAGGCTCCGAGGGCCGCGTCTGCAATGGGGAGGCGC
AGCGTTGGGGATTCCCCACTCCCCTGAGTTTCACTTCTTCTCCCAACTTGTGTCGGGTCCTTCTTCCAGGATACTCGTGA
CGCATCCCCACTTCCCACTCCCATTGGGTGTCGGATATCTAGAGAAGCCAATCAGCGTCGCCGGGGTCCCAGTTCTAAAG
TCCCCACGCACCCACCCGGACTCAGAGTCTCCTCAGACGCCGAGATGCTGGTCATGGCGCCCCGAACCGTCCTCCTGCTG
CTCTCGGCGGCCCTGGCCCTGACCGAGACCTGGGCCGGTGAGTGCGGGTCGGGAGGGAAATGGCCTCTGCCGGGAGGAGC
GAGGGGACCGCAGGCGGGGGCGCAGGACCTGAGGAGCCGCGCCGGGAGGAGGGTCGGGCGGGTCTCAGCCCCTCCTCGCC
CCCAGGCTCCCACTCCATGAGGTATTTCGACACCGCCATGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGG
GCTACGTGGACGACACGCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGAGAGGAGCCGCGGGCGCCGTGGATA
GAGCAGGAGGGGCCGGAGTATTGGGACCGGAACACACAGATCTTCAAGACCAACACACAGACTGACCGAGAGAGCCTGCG
GAACCTGCGCGGCTACTACAACCAGAGCGAGGCCGGTGAGTGACCCCGGCCCGGGGCGCAGGTCACGACTCCCCATCCCC
CACGGACGGCCCGGGTCGCCCCGAGTCTCCGGGTCCGAGATCCGCCTCCCTGAGGCCGCGGGACCCGCCCAGACCCTCGA
CCGGCGAGAGCCCCAGGCGCGTTTACCCGGTTTCATTTTCAGTTGAGGCCAAAATCCCCGCGGGTTGGTCGGGGCGGGGC
GGGGCTCGGGGGGACGGGGCTGACCGCGGGGCCGGGGCCAGGGTCTCACACCCTCCAGAGCATGTACGGCTGCGACGTGG
GGCCGGACGGGCGCCTCCTCCGCGGGCATAACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTG
CGCTCCTGGACCGCGGCGGACACCGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGGACAG
AGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGACACGCTGGAGCGCGCGGGTA
CCAGGGGCAGTGGGGAGCCTTCCCCATCTCCTATAGGTCGCCGGGGATGGCCTCCCACGAGAAGAGGAGGAAAATGGGAT
CAGCGCTAGAATGTCGCCCTCCCTTGAATGGAGAATGGCATGAGTTTTCCTGAGTTTCCTCTGAGGGCCCCCTCTTCTCT
CTAGACAATTAAGGGATGACGTCTCTGAGGAAATGGAGGGGAAGACAGTCCCTAGAATACTGATCAGGGGTCCCCTTTGA
CCCCTGCAGCAGCCTTGGGAACCGTGACTTTTCCTCTCAGGCCTTGTTCTCTGCCTCACACTCAGTGTGTTTGGGGCTCT
GATTCCAGCACTTCTGAGTCACTTTACCTCCACTCAGATCAGGAGCAGAAGTCCCTGTTCCCCGCTCAGAGACTCGAACT
TTCCAATGAATAGGAGATTATCCCAGGTGCCTGCATCCGCTGGTGTCTGGGTTCTGTGCCCCTTCCCCACCCCAGGTGTC
CTGTCCATTCTCAGGCTGGTCACATGGGTGGTCCTAGGGTGTGCCATGAGAGATGCAAAGCGCCTGAATTTTCTGACTCT
TCCCATCAGACCCCCCAAAGACACACGTGACCCACCACCCCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTG
GGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGATGGCGAGGACCAAACTCAGGACACTGAGCTTGTGGAGAC
CAGACCAGCAGGAGATAGAACCTTCCAGAAGTGGGCAGCTGTGGTGGTGCCTTCTGGAGAAGAGCAGAGATACACATGCC
ATGTACAGCATGAGGGGCTGCCGAAGCCCCTCACCCTGAGATGGGGTAAGGAGGGGGATGAGGGGTCATATCTCTTCTCA
GGGAAAGCAGGAGCCCTTCAGCAGGGTCAGGGCCCCTCATCTTCCCCTCCTTTCCCAGAGCCGTCTTCCCAGTCCACCGT
CCCCATCGTGGGCATTGTTGCTGGCCTGGCTGTCCTAGCAGTTGTGGTCATCGGAGCTGTGGTCGCTGCTGTGATGTGTA
GGAGGAAGAGCTCAGGTAGGGAAGGGGTGAGGGGTGGGGTCTGGGTTTTCTTGTCCCACTGGGGGTTTCAAGCCCCAGGT
AGAAGTGTTCCCTGCCTCATTACTGGGATGCAGCATCCACACAGGGGCTAACGCAGCCTGGGACCCTGTGTGCCAGCACT
TACTCTTTTGTGCAGCACATGTGACAATGAAGGACGGATGTATCACCTTGGTGGTTGTGGTGTTGGGGTCCTGATTCCAG
CATTCATGAGTCAGGGGAAGGTCCCTGCTAAGGACAGACCTTAGGAGGGCAGTTGGTCCAGGACCCACACTTGCTTTCCT
CGTGTTTCCTGATCCTGCCTTGGGTCTGTAGTCATACTTCTGGAAATTCCTTTTGGGTCCAAGACGAGGAGGTTCCTCTA
AGATCTCATGGCCCTGCTTCCTCCCAGTCCCCTCACAGGGCATTTTCTTCCCACAGGTGGAAAAGGAGGGAGCTACTCTC
AGGCTGCGTGTAAGTGATGGGGGTGGGAGTGTGGAGGAGCTCACCCACCCCATAATTCCTCCTGTCCCACGTCTCCTGCG
GGCTCTGACCAGGTCCTGTTTTTGTTCTACTCCAGGCAGCGACAGTGCCCAGGGCTCTGATGTGTCTCTCACAGCTTGAA
AAGGTGAGATTCTTGGGGTCTAGAGTGGGTGGGGTGGCGGGTCTGGGGGTGGGTGGGGCAGTGGGGAAAGGCCTGGGTAA
TGGAGATTCTTTGATTGGGATGTTTCGCGTGTGTGGTGGGCTGTTTAGAGTGTCATCACTTACCATGACTAACCAGAATT
TGTTCATGACTGTTGTTTTCTGTAGCCTGAGACAGCTGTCTTGTGAGGGACTGAGATGCAGGATTTCTTCACGCCTCCCC
TTTGTGACTTCAAGAGCCTCTGGCATCTCTTTCTGCAAAGGCACCTGAATGTGTCTGCGTCCCTGTTAGCATAATGTGAG
GAGGTGGAGAGACAGCCCACCCTTGTGTCCACTGTGACCCCT

IMGT/HLA

Sponsors

Animated Sponsors Logo