Allele Report for B*07:87

B*07:87 View HGVS Report
Pre-2010 Nomenclature: B*0787 Local Names: HIS_NEW_B_214_00426, HIS_NEW_B_214_00427, HIS_NEW_B_216_00490, HIS_NEW_B_267_00616, DE HIS_NEW_B_421_01365, HIS_NEW_B_463_01447
IMGT/HLA Acc No: HLA04092 OMIM Entry: *142830
Assigned: 2009-07-31 Sequence Last Modified: 2009-10-19
Source Entries: FJ346252 , FJ346253 , FJ346316 , FJ494827 , FJ875564 , FJ969942 , GQ245737 , GQ254338 , GQ345063 , GQ994071 , HM004264 , HQ337651 , HQ644387 , JF309400 , JN123822 , JN124231 , JN124300 , JN561726 , JQ436620 , JQ622166  
Cells Sequence Derived From: HG00000927 , HG00001426 , HG00002479 , HG00002480 , HG00002481 , HG00003095 , HG00003096 , HG00005038 , HG00005039 , HG10011713 , HN-05165-4 , HN-20795-6 , HN-30107-2 , HN-30108-0 , HN-48869-4 , HN-51115-3 , HN-78438-5 , HN-84250-6 , HN-92184-1 , HN-97350-0  
Known Ethnic Origin Of Source: Unknown
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 20 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNL
RGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTVAQITQRKWEAAREAEQRRAYLE
GECVEWLRRYLENGKDKLERA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGGGCTAC
GTGGACGACACCCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGAGAGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCGGAACACACAGATCTACAAGGCCCAGGCACAGACTGACCGAGAGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGCATGTACGGCTGCGACGTGGGGCCGGACGGG
CGCCTCCTCCGCGGGCATGACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGAC
CGCCGCGGACACGGTGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGG
AGGGCGAGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGACAAGCTGGAGCGCGCTG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo