Allele Report for B*07:67N

B*07:67N View HGVS Report
Pre-2010 Nomenclature: B*0767N Local Names: B*07BKH0707N
IMGT/HLA Acc No: HLA03413 OMIM Entry: *142830
Assigned: 2008-07-30 Sequence Last Modified: 2008-10-10
Source Entries: AM920503  
Cells Sequence Derived From: MHHI-602067  
Known Ethnic Origin Of Source: Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (33 aa)
SHSMRYFYTSVSRPAAGSPASSQWATWTTPSSX
Nucleotide Sequence Data (545 bps)
GCTCCCACTCCATGAGGTATTTCTACACCTCCGTGTCCCGGCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGGGCTACG
TGGACGACACCCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGAGAGGAGCCGCGGGCGCCGTGGATAGAGCAG
GAGGGGCCGGAGTATTGGGACCGGAACACACAGATCTACAAGGCCCAGGCACAGACTGACCGAGAGAGCCTGCGGAACCT
GCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGCATGTACGGCTGCGACGTGGGGCCGGACGGGC
GCCTCCTCCGCGGGCATGACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGACC
GCCGCGGACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGGA
GGGCGAGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGACAAGCTGGAGCGCGCTG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo