Allele Report for B*07:63

B*07:63 View HGVS Report
Pre-2010 Nomenclature: B*0763 Local Names: HLA-B*07vat
IMGT/HLA Acc No: HLA03237 OMIM Entry: *142830
Assigned: 2008-02-27 Sequence Last Modified: 2008-04-08
Source Entries: EU410615 , FJ588693 , FJ594502 , FJ594503 , FJ594588 , FJ594617 , FJ600617  
Cells Sequence Derived From: 263776 , HN-05697-8 , HN-12411-2 , HN-13211-7 , HN-16465-0 , HN-21642-3 , HN-6008615  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 7 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRDEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNL
RGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLE
GECVEWLRRYLENGKDKLERA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGGGCTAC
GTGGACGACACCCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGAGACGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCGGAACACACAGATCTACAAGGCCCAGGCACAGACTGACCGAGAGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGCATGTACGGCTGCGACGTGGGGCCGGACGGG
CGCCTCCTCCGCGGGCATGACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGAC
CGCCGCGGACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGG
AGGGCGAGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGACAAGCTGGAGCGCGCTG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo