Allele Report for B*07:09

B*07:09 View HGVS Report
Pre-2010 Nomenclature: B*0709 Local Names: B*07ML, B*07DKDC
IMGT/HLA Acc No: HLA00141 OMIM Entry: *142830
Assigned: 1998-03-11 Sequence Last Modified: 1999-08-06
Source Entries: AF106043 , AF106044 , AF106045 , AF132018 , AF132019 , AF132020 , AH009119 , AJ003063 , KC601846 , KC601847  
Cells Sequence Derived From: 011147550 , DKDC , MDA0000068 , MDA0000069 , TER#939  
Known Ethnic Origin Of Source: Black, Caucasoid
Publications
Elsner HA et al. Tissue Antigens 56:371-5 2000. (View abstract)
Feldman D et al. Tissue Antigens 59:426-9 2002. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 5 Laboratories: 4
HLA Dictionary Data
Expert Assigned Type: B7 WHO Assigned Type: B7
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 2 B7 [97-98%]
NMDP (2008) 8 B7 [100%]
13 IHWC (2002) 2 B7
Neural Network Assigned Type: B7
Comments:  
Protein Sequence (206 aa)
MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEG
PEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLRSWTAA
DTAAQITQRKWEAAREAEQRRAYLEGECVEWLRRYLENGKDKLERA
Nucleotide Sequence Data (619 bps)
ATGCTGGTCATGGCGCCCCGAACCGTCCTCCTGCTGCTCTCGGCGGCCCTGGCCCTGACCGAGACCTGGGCCGGCTCCCA
CTCCATGAGGTATTTCTACACCTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGGGCTACGTGGACG
ACACCCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGAGAGGAGCCGCGGGCGCCGTGGATAGAGCAGGAGGGG
CCGGAGTATTGGGACCGGAACACACAGATCTACAAGGCCCAGGCACAGACTGACCGAGAGAGCCTGCGGAACCTGCGCGG
CTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGCATGTACGGCTGCGACGTGGGGCCGGACGGGCGCCTCC
TCCGCGGGCATGACCAGTCCGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGACCGCCGCG
GACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGGAGGGCGA
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGACAAGCTGGAGCGCGCTG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo