Allele Report for B*07:02:10

B*07:02:10 View HGVS Report
Pre-2010 Nomenclature: B*070210 Local Names: HIS_NEW_B_201_00030, HIS_NEW_B_201_00042, HIS_NEW_B_214_00407, HIS_NEW_B_216_00500
IMGT/HLA Acc No: HLA03900 OMIM Entry: *142830
Assigned: 2009-05-31 Sequence Last Modified: 2009-10-19
Source Entries: FJ234987 , FJ234999 , FJ346233 , FJ346326 , GQ994063 , GU551841 , HM594776 , HQ154194 , HQ215040 , HQ337676 , HQ906901 , JN644967 , JQ359480 , JQ797357 , JQ911884 , JQ911885  
Cells Sequence Derived From: HG00001506 , HG00001961 , HG00001962 , HG00002482 , HG00003097 , HG00005040 , HG00005041 , HG00005042 , HG00005043 , HG10011613 , HG10011614 , HN-28858-1 , HN-53909-8 , HN-62104-5 , HN-87721-5 , HN-97825-6  
Known Ethnic Origin Of Source: Black
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 16 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNL
RGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLE
GECVEWLRRYLENGKDKLERA
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCTCAGTGGGCTAC
GTGGACGACACCCAGTTCGTGAGGTTCGACAGCGACGCCGCGAGTCCGAGAGAGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCGGAACACACAGATCTACAAGGCCCAGGCACAGACTGACCGAGAGAGCCTGCGGAACC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGGTCTCACACCCTCCAGAGCATGTACGGCTGCGACGTGGGGCCGGACGGG
CGCCTCCTTCGCGGGCATGACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCCTGGAC
CGCCGCGGACACGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGAGGCGGAGCAGCGGAGAGCCTACCTGG
AGGGCGAGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGACAAGCTGGAGCGCGCTG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo