Allele Report for A*02:158

A*02:158 View HGVS Report
Pre-2010 Nomenclature: A*9258 Local Names: HIS_NEW_A_192_00086
IMGT/HLA Acc No: HLA03652 OMIM Entry: *142800
Assigned: 2009-02-28 Sequence Last Modified: 2009-10-19
Source Entries: FJ222568 , FJ222574 , FJ224136 , FJ224142 , FJ224183 , FJ224217 , FJ224227 , FJ594704 , FJ594705 , FJ619443 , FJ619444 , FJ619450 , FJ765897 , FJ765905 , FJ765909 , FJ976871 , GQ132050 , GQ180322 , GQ859520 , GQ900557 , GQ994041  
Cells Sequence Derived From: HN-00731-9 , HN-19193-4 , HN-22166-0 , HN-22292-8 , HN-24072-8 , HN-28120-2 , HN-30155-4 , HN-32925-4 , HN-35480-4 , HN-40256-2 , HN-53878-6 , HN-61351-2 , HN-63730-8 , HN-73984-9 , HN-77431-0 , HN-81176-3 , HN-85226-8 , HN-86446-8 , HN-91757-5 , HN-95792-5 , HN-99545-7  
Known Ethnic Origin Of Source: Unknown
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 21 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQAHRVDLGTL
RGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLE
GTCVEWLRRYLENGKETLQRT
Nucleotide Sequence Data (546 bps)
GCTCTCACTCCATGAGGTATTTCTTCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGTCCGGAGTATTGGGACGGGGAGACACGGAAAGTGAAGGCCCACTCACAGGCTCACCGAGTGGACCTGGGGACCC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGTTCTCACACCGTCCAGAGGATGTATGGCTGCGACGTGGGGTCGGACTGG
CGCTTCCTCCGCGGGTACCACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAAAGAGGACCTGCGCTCTTGGAC
CGCGGCGGACATGGCAGCTCAGACCACCAAGCACAAGTGGGAGGCGGCCCATGTGGCGGAGCAGTTGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo