Allele Report for A*80:01:01:01

A*80:01:01:01 View HGVS Report
Pre-2010 Nomenclature: A*8001 Local Names: AX"BG", A-new
IMGT/HLA Acc No: HLA00130 OMIM Entry: *142800
Assigned: 1992-12-14 Sequence Last Modified: 1998-12-16
Source Entries: JX009131 , L18898 , L19403 , M94880 , U03754  
Cells Sequence Derived From: 32511 , 35020 , 35841 , CODI , CTM1953541 , CTM3953540 , CUI-86 , LADA , MIKA , VH  
Known Ethnic Origin Of Source: Black, Caucasoid
CWD v2.0 Status: Common
Publications
Starling GC et al. Hum Immunol 39:163-8 1994. (View abstract)
Balas A et al. Immunogenetics 39:452-452 1994. (View abstract)
Domena JD et al. Tissue Antigens 42:156-9 1993. (View abstract)
Wagner AG et al. Tissue Antigens 42:522-9 1993. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 10 Laboratories: 5
HLA Dictionary Data
Expert Assigned Type: A80 WHO Assigned Type: A80
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 11 A80 [68-88%] A36 [0-3%]
NMDP (2008) 505 Blank [77%] A80 [10%] A36 [2%] A1 [1%]
13 IHWC (2002) 9 A80
Neural Network Assigned Type: Training - A80
Comments: ihw13: difficult to type next to A1 or A24 
Protein Sequence (365 aa)
MAVMPPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDSQFVQFDSDAASQRMEPRAPWIEQEE
PEYWDEETRNVKAHSQTNRANLGTLRGYYNQSEDGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAA
DMAAQITKRKWEAARRAEQLRAYLEGECVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALSFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGKEKRYTCHVQHEGLPEPLTLRWEPSSQPTIPIVGIIAGLVLLGA
VIAGAVVAAVMWRKKSSVRKGGSYSQAASSDSAQGSDVSLTACKV
Nucleotide Sequence Data (1098 bps)
ATGGCCGTCATGCCGCCCCGAACCCTCCTCCTGCTACTCTCGGGGGCCCTGGCCCTGACCCAGACCTGGGCAGGCTCCCA
CTCCATGAGGTATTTCTTCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCAGTGGGCTACGTGGACG
ACTCGCAGTTCGTGCAGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCAGGAGGAG
CCGGAGTATTGGGACGAGGAGACACGGAATGTGAAGGCCCACTCACAGACTAACCGAGCGAACCTGGGGACCCTGCGCGG
CTACTACAACCAGAGCGAGGACGGTTCTCACACCATCCAGATAATGTATGGCTGCGACGTGGGGTCGGACGGGCGCTTCC
TCCGCGGGTACCGGCAGGACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCTTGGACCGCGGCG
GACATGGCGGCTCAGATCACCAAGCGCAAGTGGGAGGCGGCCCGTCGGGCGGAGCAGCTGAGAGCCTACCTGGAGGGCGA
GTGCGTGGACGGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGGACCCCCCCAAGACACATATGA
CCCACCACCCCATCTCTGACCATGAGGCCACTCTGAGGTGCTGGGCCCTGAGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGGGAGGACCAGACCCAGGACACGGAGCTCGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAA
GTGGGCGGCTGTGGTGGTACCTTCTGGAAAGGAGAAGAGATACACCTGCCATGTGCAGCATGAGGGTCTGCCCGAGCCCC
TCACCCTGAGATGGGAGCCATCTTCCCAGCCCACCATCCCCATTGTGGGCATCATTGCTGGCCTGGTTCTCCTTGGAGCT
GTGATCGCTGGAGCTGTGGTCGCTGCCGTGATGTGGAGGAAGAAGAGCTCAGTTAGAAAAGGAGGGAGCTACTCTCAGGC
TGCAAGCAGTGACAGTGCCCAGGGCTCTGATGTGTCTCTCACAGCTTGTAAAGTGTGA
Genomic Sequence Data (3263 bps)
ACCTATGTAGGGTCCTTCTTCCTGGATACTCACGACGCGGACCCAGTTCTCACTCCAATTGGGTGTCGGGTTTCCAGAGA
AGCCAATCAGTGTCGTCGCGGTCGCGGTTCTAAAGTCCGCACGCACCCACCGGGACTCAGATTCTCCCCAGACGCCGAGG
ATGGCCGTCATGCCGCCCCGAACCCTCCTCCTGCTACTCTCGGGGGCCCTGGCCCTGACCCAGACCTGGGCAGGTGAGTG
CGGGGTCGGGAGGGAAACGGCCTCTGCGGGGAGAAGCAAGGGGCCCGCCCGGCGGGGGCGCAGGACCCGGGAAGCCGCGC
CGGGAGGAGGGTCGGGCGGGTCTCAGCCACTCCTCGCCCCCAGGCTCCCACTCCATGAGGTATTTCTTCACATCCGTGTC
CCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCAGTGGGCTACGTGGACGACTCGCAGTTCGTGCAGTTCGACAGCGACG
CCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCAGGAGGAGCCGGAGTATTGGGACGAGGAGACACGGAAT
GTGAAGGCCCACTCACAGACTAACCGAGCGAACCTGGGGACCCTGCGCGGCTACTACAACCAGAGCGAGGACGGTGAGTG
ACCCCGGCCCGGGGCGCAGGTCACGACCCCTCATCCCCTACGGACGGGCCAGGTCGCCCACAGTCTCCGGGTCCGAGATC
CACCCCGAAGCCGCGGGACCCCGAGACCCTTGCCCCGGGAGAGGCCCAGGCGCCTTTAGCCGGTTTCATTTTCAGTTTAG
GCCAAAAATCCCCCCGGGTGGGTCGGGGCGGGGCGGGGCTCGGGGGACCGGGCTGACCGCGGGGTCGGGGCCAGGTTCTC
ACACCATCCAGATAATGTATGGCTGCGACGTGGGGTCGGACGGGCGCTTCCTCCGCGGGTACCGGCAGGACGCCTACGAC
GGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCTTGGACCGCGGCGGACATGGCGGCTCAGATCACCAAGCGCAA
GTGGGAGGCGGCCCGTCGGGCGGAGCAGCTGAGAGCCTACCTGGAGGGCGAGTGCGTGGACGGGCTCCGCAGATACCTGG
AGAACGGGAAGGAGACGCTGCAGCGCACGGGTACCAGGGGCCACGGGGCGCCTTCCTGATCGCCTGTAGATCTCCCGGGC
TGGCCTCCCACAAGGAGGGGAGACAATTGGGACCAACACTAGAATATCACCCTCCCTCTGCTCCTGAGGGAGAGGAATCC
TCCTGGGTTTCCAGATTCTGTACCAGAGAGTGACTCTGAGGTTCCGCCCTGCTCTCTGACACAATTAAGGGATAAAAATC
TCTGAAGGAATGACGGGAAGACGATCCCTCGAATACTGATGAGTGGTTCCCTTTGACACACACCGGCGGCAGCCTTGGGC
CCGTGACTTTTCCTCTCAGGCCTCGTTCTCTGCTTCACACTCAATATGTGTGGGGGTCTGAGTCCAGCACTTCTGAGTCT
CTCAGCCTCCACTCAGGTCAGGACCAGAAGTCGCTGTTCCCTCTGCAGGGAATAGAAGATTATCCCAGGTGCCTGTGTCC
AGGCTGGTCTGGGTTCTGTGCTCTCTTCCCCATCCCAGGTGTCCTGTCCATCCTCAAAATGGCCACATGCGTGCTGGTGG
AGTGTCCCATGACAGATGCAAAATGGCTGAATGTTCTGACTCTTCCCGTCAGACCCCCCCAAGACACATATGACCCACCA
CCCCATCTCTGACCATGAGGCCACTCTGAGGTGCTGGGCCCTGAGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGC
GGGATGGGGAGGACCAGACCCAGGACACGGAGCTCGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAAGTGGGCG
GCTGTGGTGGTACCTTCTGGAAAGGAGAAGAGATACACCTGCCATGTGCAGCATGAGGGTCTGCCCGAGCCCCTCACCCT
GAGATGGGGTAAGGAGGGAGATGGGGGTGTCATGTCTCTTAGGGAAAGCAGGAGCCTCTCTGGAGACCTTTATCAGGGTC
AGAGCCCCTCACCTTCCCCTCTTTTCCCAGAGCCATCTTCCCAGCCCACCATCCCCATTGTGGGCATCATTGCTGGCCTG
GTTCTCCTTGGAGCTGTGATCGCTGGAGCTGTGGTCGCTGCCGTGATGTGGAGGAAGAAGAGCTCAGGTGGAGAAGGGGT
GAAGGGTGGGGTCTGAGATTTCTTGTCTCACTGAGGGTTCCAAGCCCCAGCTAGAAATGTGCCCTGTCTCATTCCTGGGA
AGCACCACCCACAATCATGGGCCCACCCAGCCTGGGCCCTGTGTGCCAGCACTTACTCTTTTGTAAAGCACCTGTGACAA
TGAAGGACAGATTTATCACCTTGATTATGGCGGTGATGGGACCTGATCCCAGCAGTCACAAGTCACAGGGGAAGGTCCCT
GAGGACAGACCTCAGGAGGGCGGTTGGTCCAGGACCCACACCTGCTTTCTTCATGTTTCCTGATCCTGCCCTGGGTCTGC
ATTCACACATTTCTGGAAACTTCTCTGGGGTCCAAGGCTACGAGGTTCCTCTAGGACCTTAAGGCCCTGGCTCCTTTCTG
GTAGCTCACAGGACATTTTCTTCCCACAGTTAGAAAAGGAGGGAGCTACTCTCAGGCTGCAAGTAAGTATGAAGGAGGCT
GATGCCTGAGGTCCTTGGGATATTGTGGTTGGGAGCCCATGGGGGAGCTCACCCACCCCACAATTCCTCCTCTAGCCACA
TCTTCTGTGGGATCTGACCAGGTTCTGTTTTTGTTCTACCCCAGGCAGTGACAGTGCCCAGGGCTCTGATGTGTCTCTCA
CAGCTTGTAAAGGTGAGAGCCTGGAGGGCCTGATGTGTGTTGGGTGTTGGGGGGAACAGTGGACACAGCTGTGCTATGGG
GTTTCTTTGCATTGGATGTATTGAGCATGCGATGGGCTGTTTAAAGTGTGACCCCTCACTGTGATGGATATGAATTTGTT
CATGAATATTTTTTCTATAGTGTGAGACAGCTGCCTTGTGTGGGACTGAGAGGCAAGAGTTGTTCCTGCCCTTCCCTTTG
TGACTTGAAGAACCCTGACTTTGTTTCTGCAAAGGCACCTGCATGTGTCTGTGTTGGTGTAGGCATAATGTGAGGAGATA
GGGAGACCCACCCCACCCCCATGTCCACCATGACCCTCTTCCCACGCTGACCTGTGCTCCCTC

IMGT/HLA

Sponsors

Animated Sponsors Logo