Allele Report for A*74:11

A*74:11 View HGVS Report
Pre-2010 Nomenclature: A*7411 Local Names: NT00585
IMGT/HLA Acc No: HLA02254 OMIM Entry: *142800
Assigned: 2005-06-30 Sequence Last Modified: 2011-10-10
Source Entries: AH015076 , DQ086788 , DQ086789 , DQ888175 , EU029781 , FR799755 , JX083060  
Alignment of CDS Source Entries
A*01:01:01:01
A*74:11
Submission 1
Submission 2
Submission 3
Submission 4
Submission 5

Locus Reference
  Virtual entry for A*74:11 
  Individual submission(s) 

This feature is not currently available for some submissions of this allele.
Cells Sequence Derived From: 32876 , BY00195 , MDA0000014 , NT00585 , NT00639  
Known Ethnic Origin Of Source: Black, Caucasoid
CWD v2.0 Status: Well-Documented
ISO OID: 2.16.840.1.113883.13.252 (HL7 Registered Organisational OID)
2.16.840.1.113883.13.252.1.1.2254 (Allele OID)
Publications
Tu B et al. Tissue Antigens 69:73-85 2007. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 5 Laboratories: 3
HLA Dictionary Data
Expert Assigned Type: A74 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) 1
13 IHWC (2002) - -
Neural Network Assigned Type: A74
Comments:
Protein Sequence (364 aa)
MAVMAPRTLLLLLLGALALTQTRAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMESRAPWIEQEG
PEYWDQETRNVKAHSQTDRVDLGTLRGYYNQSEAGSHTIQMMYGCDVGPDGRLLRGYQQDAYDGKDYIALNEDLRSWTAA
DMAAQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRYTCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGA
MFAGAVVAAVRWRRKSSDRKGGSYSQAASSDSAQGSDMSLTACK
Nucleotide Sequence Data (1093 bps)
ATGGCCGTCATGGCGCCCCGAACCCTCCTCCTGCTACTCTTGGGGGCCCTGGCCCTGACCCAGACCAGGGCGGGCTCCCA
CTCCATGAGGTATTTCTTCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTTGACAGCGACGCCGCGAGCCAGAGGATGGAGTCGCGGGCGCCGTGGATAGAGCAGGAGGGG
CCGGAGTATTGGGACCAGGAGACACGGAATGTGAAGGCCCACTCACAGACTGACCGAGTGGACCTGGGGACCCTGCGCGG
CTACTACAACCAGAGCGAGGCCGGTTCTCACACCATCCAGATGATGTATGGCTGCGACGTGGGGCCGGACGGGCGCCTCC
TCCGCGGGTACCAGCAGGACGCCTACGACGGCAAGGATTACATCGCCTTGAACGAGGACCTGCGCTCTTGGACCGCGGCG
GACATGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGTTGAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGGACGCCCCCAAGACGCATATGA
CTCACCACGCTGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGAGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGGGAGGACCAGACCCAGGACACGGAGCTTGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAA
GTGGGCGTCTGTGGTGGTGCCTTCTGGACAGGAGCAGAGATACACCTGCCATGTGCAGCATGAGGGTCTGCCCAAGCCCC
TCACCCTGAGATGGGAGCCGTCTTCCCAGCCCACCATCCCCATCGTGGGCATCATTGCTGGCCTAGTTCTCTTTGGAGCT
ATGTTCGCTGGAGCTGTGGTCGCTGCTGTGAGGTGGAGGAGGAAGAGCTCAGATAGAAAAGGAGGGAGCTACTCTCAGGC
TGCAAGCAGTGACAGTGCCCAGGGCTCTGATATGTCTCTCACAGCTTGTAAAG
Genomic Sequence Data (0 bps)
Not Currently Available

IPD-IMGT/HLA

Sponsors