Allele Report for A*74:04

A*74:04 View HGVS Report
Pre-2010 Nomenclature: A*7404 Local Names: U3765
IMGT/HLA Acc No: HLA01115 OMIM Entry: *142800
Assigned: 1999-11-17 Sequence Last Modified: 2003-07-12
Source Entries: AJ249370  
Cells Sequence Derived From: U3765  
Known Ethnic Origin Of Source: Black
Publications
Cox ST et al. Tissue Antigens 57:70-2 2001. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: A74 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) 1 A74 [100%]
13 IHWC (2002) - -
Neural Network Assigned Type: A74
Comments:
Protein Sequence (181 aa)
SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTDRVDLGTL
RGYYNQSEAGSHTIQMMYGCDVGPDGRLLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLE
GTCVEWLRRYLENGKETLQRT
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTTCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTTGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGTCCGGAGTATTGGGACGGGGAGACACGGAAAGTGAAGGCCCACTCACAGACTGACCGAGTGGACCTGGGGACCC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGTTCTCACACCATCCAGATGATGTATGGCTGCGACGTGGGGCCGGACGGG
CGCCTCCTCCGCGGGTACCAGCAGGACGCCTACGACGGCAAGGATTACATCGCCTTGAACGAGGACCTGCGCTCTTGGAC
CGCGGCGGACATGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGTTGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo