Allele Report for A*68:12

A*68:12
Pre-2010 Nomenclature: A*6812 Local Names: None
IMGT/HLA Acc No: HLA01046 OMIM Entry: *142800
Assigned: 1999-04-30 Sequence Last Modified: 2008-10-10
Source Entries: AJ238362 , AJ238363 , AJ238364 , EU924803  
Cells Sequence Derived From: KE-GF , NT01008  
Known Ethnic Origin Of Source: Caucasoid
Publications
Fae I et al. Tissue Antigens 56:276-8 2000. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: A28 WHO Assigned Type: A28
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) 6 A28 [50%] blank [50%]
13 IHWC (2002) - -
Neural Network Assigned Type: A68
Comments: Short A28 
Protein Sequence (199 aa)
TLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRN
TRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALKEDLRSWTAADMAAQIT
KHKWEAAHVAEQWRAYLEGTCVEWLRRYLENGKETLQRT
Nucleotide Sequence Data (598 bps)
ACCCTCGTCCTGCTACTCTCGGGGGCCCTGGCCCTGACCCAGACCTGGGCGGGCTCCCACTCCATGAGGTATTTCTACAC
TTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTACGTGGACGACACGCAGTTCGTGCGGTTCG
ACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCAGGAGGGGCCGGAGTATTGGGACCGGAAC
ACACGGAATGTGAAGGCCCAGTCACAGACTGACCGAGTGGACCTGGGGACCCTGCGCGGCTACTACAACCAGAGCGAGGC
CGGTTCTCACACCATCCAGATGATGTATGGCTGCGACGTGGGGTCGGACGGGCGCTTCCTCCGCGGGTACCGGCAGGACG
CCTACGACGGCAAGGATTACATCGCCCTGAAAGAGGACCTGCGCTCTTGGACCGCGGCGGACATGGCAGCTCAGATCACC
AAGCACAAGTGGGAGGCGGCCCATGTGGCGGAGCAGTGGAGAGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCAG
ATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo