Allele Report for A*34:04

A*34:04 View HGVS Report
Pre-2010 Nomenclature: A*3404 Local Names: A34new
IMGT/HLA Acc No: HLA01320 OMIM Entry: *142800
Assigned: 2000-08-31 Sequence Last Modified: 2001-04-09
Source Entries: AJ297499 , AJ297500  
Cells Sequence Derived From: ATG  
Known Ethnic Origin Of Source: Unknown
Publications
Voorter CE et al. Tissue Antigens 60:328-30 2002. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: A34 WHO Assigned Type: A34(10)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) 2 A34
Neural Network Assigned Type: A34
Comments: ihw13: short A34, with some A11 and A19 sera reactive; A34 var with some A10 sera reactive 
Protein Sequence (181 aa)
SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQERPEYWDRNTRNVKAQSQTDRVDLGTL
RGYYNQSEDGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWETAHEAEQLRAYLE
GTCVEWLRRYLENGKETLQRT
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGAGGCCGGAGTATTGGGACCGGAACACACGGAATGTGAAGGCCCAGTCACAGACTGACCGAGTGGACCTGGGGACCC
TGCGCGGCTACTACAACCAGAGCGAGGACGGTTCTCACACCATCCAGATAATGTATGGCTGCGACGTGGGGTCGGACGGG
CGCTTCCTCCGCGGGTACCGGCAGGACGCTTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCTTGGAC
CGCGGCGGACATGGCGGCTCAGATCACCCAGCGCAAGTGGGAGACGGCCCATGAGGCGGAGCAGTTGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo