Allele Report for A*33:44

A*33:44 View HGVS Report
Pre-2010 Nomenclature: Local Names: HLA-A
IMGT/HLA Acc No: HLA06372 OMIM Entry: *142800
Assigned: 2011-01-31 Sequence Last Modified: 2011-04-08
Source Entries: FR690488 , HQ873871  
Cells Sequence Derived From: D10011031 , GZHLAD69  
Known Ethnic Origin Of Source: Oriental
Publications
Ye X et al. Tissue Antigens 82:140-142 2013. (View abstract)
Li J et al. Tissue Antigens 78:267-270 2011. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (273 aa)
SHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAHSQIDRVDLGTL
RGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLE
GTCVEWLRRYLENGKETLQRTDPPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTF
QKWASVVVPSGQEQRYTCHVQHEDLPKPLTLRW
Nucleotide Sequence Data (822 bps)
GCTCCCACTCCATGAGGTATTTCACCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCGGAACACACGGAATGTGAAGGCCCACTCACAGATTGACCGAGTGGACCTGGGGACCC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGTTCTCACACCATCCAGATGATGTATGGCTGCGACGTGGGGTCGGACGGG
CGCTTCCTCCGCGGGTACCAGCAGGACGCCTACGACGGCAAGGATTACATCGCCTTGAACGAGGACCTGCGCTCTTGGAC
CGCGGCGGACATGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGTTGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGGACCCCCCCAAGACG
CATATGACTCACCACGCTGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGAGCTTCTACCCTGCGGAGATCAC
ACTGACCTGGCAGCGGGATGGGGAGGACCAGACCCAGGACACGGAGCTCGTGGAGACCAGGCCTGCAGGGGATGGAACCT
TCCAGAAGTGGGCGTCTGTGGTGGTGCCTTCTGGACAGGAGCAGAGATACACCTGCCATGTGCAGCATGAGGATCTCCCC
AAGCCCCTCACCCTGAGATGGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo