Allele Report for A*33:10

A*33:10 View HGVS Report
Pre-2010 Nomenclature: A*3310 Local Names: NT00715
IMGT/HLA Acc No: HLA02807 OMIM Entry: *142800
Assigned: 2007-02-28 Sequence Last Modified: 2007-04-12
Source Entries: EF375695  
Cells Sequence Derived From: NT00715  
Known Ethnic Origin Of Source: Caucasoid
Publications
Lazaro AM et al. Tissue Antigens 74:238-240 2009. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: A33 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) - -
Neural Network Assigned Type: A33
Comments:
Protein Sequence (181 aa)
SHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAHSQIDRVDLGTL
RGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLE
GTCVDGLRRYLENGKETLQRT
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCACCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCGGAACACACGGAATGTGAAGGCCCACTCACAGATTGACCGAGTGGACCTGGGGACCC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGTTCTCACACCATCCAGATGATGTATGGCTGCGACGTGGGGTCGGACGGG
CGCTTCCTCCGCGGGTACCAGCAGGACGCCTACGACGGCAAGGATTACATCGCCTTGAACGAGGACCTGCGCTCTTGGAC
CGCGGCGGACATGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGTTGAGAGCCTACCTGG
AGGGCACGTGCGTGGACGGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo