Allele Report for A*32:01:01

A*32:01:01 View HGVS Report
Pre-2010 Nomenclature: A*320101 Local Names: A32
IMGT/HLA Acc No: HLA00101 OMIM Entry: *142800
Assigned: 1989-08-01 Sequence Last Modified: 1998-12-16
Source Entries: AJ555413 , BX005091 , EU445480 , HG794386 , HM357869 , P10314 , U03907  
Cells Sequence Derived From: 7550801133 , AM , B9188 , PACO752792 , SSTO  
Known Ethnic Origin Of Source: Caucasoid, Oriental
Publications
Wan AM et al. J Immunol 137:3671-4 1986. (View abstract)
Zhu F et al. Int J Immunogenet 36:351-360 2009. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 5 Laboratories: 6
HLA Dictionary Data
Expert Assigned Type: A32 WHO Assigned Type: A32(19)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 20 A32 [97-99%]
NMDP (2008) 3441 A32 [94%]
13 IHWC (2002) 50 A32
Neural Network Assigned Type: Training - A32
Comments:
Protein Sequence (365 aa)
MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEG
PEYWDQETRNVKAHSQTDRESLRIALRYYNQSEAGSHTIQMMYGCDVGPDGRLLRGYQQDAYDGKDYIALNEDLRSWTAA
DMAAQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRYTCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGA
MFAGAVVAAVRWRRKSSDRKGGSYSQAASSDSAQGSDMSLTACKV
Nucleotide Sequence Data (1098 bps)
ATGGCCGTCATGGCGCCCCGAACCCTCCTCCTGCTACTCTTGGGGGCCCTGGCCCTGACCCAGACCTGGGCGGGCTCCCA
CTCCATGAGGTATTTCTTCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTTGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCAGGAGGGG
CCGGAGTATTGGGACCAGGAGACACGGAATGTGAAGGCCCACTCACAGACTGACCGAGAGAGCCTGCGGATCGCGCTCCG
CTACTACAACCAGAGCGAGGCCGGTTCTCACACCATCCAGATGATGTATGGCTGCGACGTGGGGCCGGACGGGCGCCTCC
TCCGCGGGTACCAGCAGGACGCCTACGACGGCAAGGATTACATCGCCTTGAACGAGGACCTGCGCTCTTGGACCGCGGCG
GACATGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGTTGAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGGACGCCCCCAAGACGCATATGA
CTCACCACGCTGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGAGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGGGAGGACCAGACCCAGGACACGGAGCTTGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAA
GTGGGCGTCTGTGGTGGTGCCTTCTGGACAGGAGCAGAGATACACCTGCCATGTGCAGCATGAGGGTCTGCCCAAGCCCC
TCACCCTGAGATGGGAGCCGTCTTCCCAGCCCACCATCCCCATCGTGGGCATCATTGCTGGCCTAGTTCTCTTTGGAGCT
ATGTTCGCTGGAGCTGTGGTCGCTGCTGTGAGGTGGAGGAGGAAGAGCTCAGATAGAAAAGGAGGGAGCTACTCTCAGGC
TGCAAGCAGTGACAGTGCCCAGGGCTCTGATATGTCTCTCACAGCTTGTAAAGTGTGA
Genomic Sequence Data (3518 bps)
CAGGAGCAGAGGGGTCAGGGCGAAGTCCCAGGGCCCCAGGCGTGGCTCTCAGGGTCTCAGGCCCCGAAGGCGGTGTATGG
ATTGGGGAGTCCCAGCCTTGGGGATTCCCCAACTCCGCAGTTTCTTTTCTCCCTCTGCCAACCTATGTAGGGTCCTTCTT
CCTGGATACTCACGACGCGGACCCAGTTCTCACTCCCATTGGGTGTCGGGTTTCCAGAGAAGCCAATCAGTGTCGTCGCG
GTCGCGGTTCTAAAGTCCGCACGCACCCACCGGGACTCAGATTCTCCCCAGACGCCGAGGATGGCCGTCATGGCGCCCCG
AACCCTCCTCCTGCTACTCTTGGGGGCCCTGGCCCTGACCCAGACCTGGGCGGGTGAGTGCGGGGTCGTGGGGAAACCGC
CTCTGCGGGGAGAAGCAAGGGGCCCGCCCGGCGGGGGCGCAGGACCCGGGTAGCCGCGCCGGGAGGAGGGTCGGGCGGGT
CTCAGCCACTCCTCGCCCCCAGGCTCCCACTCCATGAGGTATTTCTTCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCC
CCGCTTCATCGCCGTGGGCTACGTGGACGACACGCAGTTCGTGCGGTTTGACAGCGACGCCGCGAGCCAGAGGATGGAGC
CGCGGGCGCCGTGGATAGAGCAGGAGGGGCCGGAGTATTGGGACCAGGAGACACGGAATGTGAAGGCCCACTCACAGACT
GACCGAGAGAGCCTGCGGATCGCGCTCCGCTACTACAACCAGAGCGAGGCCGGTGAGTGACCCCGGCCCGGGGCGCAGGT
CACGACCTCTCATCCCCCACGGACGGGCCAGGTCGCCCACAGTCTCCGGGTCCGAGATCCACCCCGAAGCCGCGGGACCC
CGAGACCCTTGCCCCGGGAGAGGCCCAGGCGCCTTTACCCGGTTTCATTTTCAGTTTAGGCCAAAAATCCCCCCGGGTTG
GTCGGGGCCGGACGGGGCTCGGGGGACTGGGCTGACCGTGGGGTCGGGGCCAGGTTCTCACACCATCCAGATGATGTATG
GCTGCGACGTGGGGCCGGACGGGCGCCTCCTCCGCGGGTACCAGCAGGACGCCTACGACGGCAAGGATTACATCGCCTTG
AACGAGGACCTGCGCTCTTGGACCGCGGCGGACATGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGC
GGAGCAGTTGAGAGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGC
AGCGCACGGGTACCAGGGGCCACGGGGCGCCTCCCTGATCGCCTGTAGATCTCCCGGGCTGGCCTCCCACAAGGAGGGGA
GACAATTGGGACCAACACTAGAATATCGCCCTCCCTCTGGTCCTGAGGGAGAGGAATCCTCCTGGGTTTCCAGATCCTGT
ACCAGAGAGTGACTCTGAGGTTCCGCCCTGCTCTCTGACACAATTAAGGGATAAAATCTCTGAAGGAATGACGGGAAGAC
GATCCCTCGAATACTGATGAGTGGTTCCCTTTGACACACACCGGCAGCAGCCTTGGGCCCGTGACTTTTCCTCTCAGGCC
TTGTTCTCTGCTTCACACTCAATGTGTGTGGGGGTCTGAGTCCAGCACTTCTGAGTCCCTCAGCCTCCACTCAGGTCAGG
ACCAGAAGTCGCTGTTCCCTCTTCAGGGACTAGAATTTTCCACGGAATAGGAGATTATCCCAGGTGCCTGTGTCCAGGCT
GGTGTCTGGGTTCTGTGCTCCCTTCCCCATCCCAGGTGTCCTGTCCATTCTCAAGATAGCCACATGTGTGCTGGAGGAGT
GTCCCATGACAGATGCAAAATGCCTGAATGTTCTGACTCTTCCTGACAGACGCCCCCAAGACGCATATGACTCACCACGC
TGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGAGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGG
ATGGGGAGGACCAGACCCAGGACACGGAGCTTGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAAGTGGGCGTCT
GTGGTGGTGCCTTCTGGACAGGAGCAGAGATACACCTGCCATGTGCAGCATGAGGGTCTGCCCAAGCCCCTCACCCTGAG
ATGGGGTAAGGAGGGAGATGGGGGTGTCATGTCTTTTACGGAAAGCAGGAGCCTCTCTGACCTTTAGCAGGGTCAGGGCC
CCTCACCTTCCCCTCTTTTCCCAGAGCCGTCTTCCCAGCCCACCATCCCCATCGTGGGCATCATTGCTGGCCTAGTTCTC
TTTGGAGCTATGTTCGCTGGAGCTGTGGTCGCTGCTGTGAGGTGGAGGAGGAAGAGCTCAGGTGGGGTGAAGGGATGAAG
GGTGGGTCTGAGATTTCTTGTCTCACTGAGGGTTCCAAGACCCAGGTAGAAGTGTGCCCTGCCTCGTTACTGGGAAGCAC
CATCCACAATTATGGGCCTACCCAGCCTGGGCCCTGTGTGCCAGCACTTACTCTTTTGTAAAGCACCTGTTAAAATGAAG
GACAGATTTATCACCTTGATTACGGCGGTGATGGGACCTGATCCCAGCAGTCACAAGTCACAGGGGAAGGTCCCTGAGGA
CCTTCAGGAGGGCGGTTGGTCCAGGACCCACACCTGCTTTCTTCATGTTTCCTGATCCCGCCCTGGGTCTGCAGTCACAC
ATTTCTGGAAACTTCTCTGAGGTCCAAGACTTGGAGGTTCCTCTAGGACCTTAAGGCCCTGGCTCCTTTCTGGTATCTCA
CAGGACATTTTCTTCCCACAGATAGAAAAGGAGGGAGCTACTCTCAGGCTGCAAGTAAGTATGAAGGAGGCTGATGCCTG
AGGTCCTTGGGATATTGTGTTTGGGAGCCCGTGGGGGAGCTCACCCACCCCACAATTCCTCCTCTAGCCACATCTTCTGT
GGGATCTGACCAGGTTCTGTTTTTGTCCTACCCCAGGCAGTGACAGTGCCCAGGGCTCTGATATGTCTCTCACAGCTTGT
AAAGGTGAGAGCCTGGAGGGCCTGATGTGTGTTGGGTGTTGGGCGGAACAGTGGACGCAGCTGTGCTATGGGGTTTCTTT
GCATTGGATGTATTGAGCATGCGATGGGCTGTTTAAAGTGTGACTCCTCACTGTGACAGATACGAATTTGTTCATGAATA
TTTTTTTCTATAGTGTGAGACAGCTGCCTTGTGTGGGACTGAGAGGCAAGATTTGTTCCTGCCCTTCCCTTTGTGACTTG
AAGAACCCTGACTTTGTTTCTGCAAAGGCACCTGCATGTGTCTGTGTTCTTGTAGGCATAATGTGAGGAGGTGGGGAGAC
CACCCCACCCCCATGTCCACCATGACCCTCTTCCCACGCTGACCTGTGCTCCCTCCCCAATCATCTTTCCTGTTCCAGAG
AGGTGGGGCTGAGGTGTCTCCATCTCTGCCTCAACTTCATGGTGCACTGAGCTGTAACTTCTTCCTTCCCTATTAAAA

IMGT/HLA

Sponsors

Animated Sponsors Logo