Allele Report for A*31:27

A*31:27 View HGVS Report
Pre-2010 Nomenclature: A*3127 Local Names: HIS_NEW_A_196_00126, HIS_NEW_A_375_00582
IMGT/HLA Acc No: HLA03925 OMIM Entry: *142800
Assigned: 2009-06-30 Sequence Last Modified: 2009-10-19
Source Entries: FJ224182 , FJ765932 , GQ160980 , GQ160981 , GQ160985 , GQ161013 , GQ199651 , GQ199692 , GQ199704 , GQ254316 , GQ449625 , GQ914774 , GQ914776 , GU136151 , GU136152 , HM362797 , HQ011334 , HQ337692 , HQ590390  
Cells Sequence Derived From: HG00000027 , HG00000028 , HG00000029 , HG00000030 , HG00000776 , HG00000777 , HN-05636-4 , HN-06359-5 , HN-21895-8 , HN-27846-7 , HN-51328-8 , HN-73973-6 , HN-76475-8 , HN-82794-0 , HN-85343-1 , HN-85344-9 , HN-86572-0 , HN-9058547 , HN-92083-2  
Known Ethnic Origin Of Source: Unknown
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 19 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPWAPWIEQERPEYWDQETRNVKAHSQIDRVDLGTL
RGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLE
GTCVEWLRRYLENGKETLQRT
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCACCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGTGGGCGCCGTGGATAGAGCA
GGAGAGGCCTGAGTATTGGGACCAGGAGACACGGAATGTGAAGGCCCACTCACAGATTGACCGAGTGGACCTGGGGACCC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGTTCTCACACCATCCAGATGATGTATGGCTGCGACGTGGGGTCGGACGGG
CGCTTCCTCCGCGGGTACCAGCAGGACGCCTACGACGGCAAGGATTACATCGCCTTGAACGAGGACCTGCGCTCTTGGAC
CGCGGCGGACATGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGTTGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo