Allele Report for A*31:26

A*31:26 View HGVS Report
Pre-2010 Nomenclature: A*3126 Local Names: HIS_NEW_A_192_00078, HIS_NEW_A_194_00100, HIS_NEW_A_196_00124, HIS_NEW_A_197_00132, DE HIS_NEW_A_199_00148, HIS_NEW_A_199_00150, HIS_NEW_A_370_00576, HIS_NEW_A_475_00824, DE HIS_NEW_A_475_00833, HIS_NEW_A_476_00844
IMGT/HLA Acc No: HLA03920 OMIM Entry: *142800
Assigned: 2009-06-30 Sequence Last Modified: 2009-10-19
Source Entries: FJ224134 , FJ224156 , FJ224180 , FJ224188 , FJ224204 , FJ224206 , FJ765915 , FJ976734 , FJ976743 , FJ976754 , GQ160988 , GQ160989 , GQ160992 , GQ161019 , GQ161020 , GQ180330 , GQ199666 , GQ199685 , GQ240344 , GQ240527 , GQ240528 , GQ449620 , GQ859507  
Alignment of CDS Source Entries
A*01:01:01:01
A*31:26
Submission 1
Submission 2
Submission 3
Submission 4

Locus Reference
  Virtual entry for A*31:26 
  Individual submission(s) 

This feature is not currently available for some submissions of this allele.
Cells Sequence Derived From: HN-02272-3 , HN-15148-9 , HN-16313-3 , HN-28488-4 , HN-34412-1 , HN-35437-1 , HN-38472-2 , HN-38968-2 , HN-45545-3 , HN-48698-5 , HN-52155-8 , HN-53488-9 , HN-53647-0 , HN-57919-3 , HN-62998-9 , HN-69195-0 , HN-70217-3 , HN-72564-3 , HN-78362-1 , HN-79551-8 , HN-87418-8 , HN-88007-2 , HN-98435-1  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Well-Documented
ISO OID: 2.16.840.1.113883.13.252 (HL7 Registered Organisational OID)
2.16.840.1.113883.13.252.1.1.3920 (Allele OID)
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 23 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQERPEYWDQETRNVKAHSQIDRVDLGTL
RGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYQQDAYDGKDYIPLNEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLE
GTCVEWLRRYLENGKETLQRT
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCACCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGAGGCCTGAGTATTGGGACCAGGAGACACGGAATGTGAAGGCCCACTCACAGATTGACCGAGTGGACCTGGGGACCC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGTTCTCACACCATCCAGATGATGTATGGCTGCGACGTGGGGTCGGACGGG
CGCTTCCTCCGCGGGTACCAGCAGGACGCCTACGACGGCAAGGATTACATCCCCTTGAACGAGGACCTGCGCTCTTGGAC
CGCGGCGGACATGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGTTGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGG
Genomic Sequence Data (0 bps)
Not Currently Available

IPD-IMGT/HLA

Sponsors