Allele Report for A*31:14N

A*31:14N View HGVS Report
Pre-2010 Nomenclature: A*3114N Local Names: A*31null allele
IMGT/HLA Acc No: HLA02651 OMIM Entry: *142800
Assigned: 2006-08-23 Sequence Last Modified: 2006-10-06
Source Entries: DQ899174  
Cells Sequence Derived From: DSA31N  
Known Ethnic Origin Of Source: Caucasoid
Publications
Smith DM et al. Tissue Antigens 68:526-7 2006. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: Not expressed WHO Assigned Type: Null
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) - -
Neural Network Assigned Type: Not tested
Comments:
Protein Sequence (220 aa)
MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQER
PEYWDQETRNVKAHSQIDRVDLGTLRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYQQDAYDGKDYIALNEDLRSWTAA
DMAAQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDPPQDAYDSPRCLX
Nucleotide Sequence Data (1099 bps)
ATGGCCGTCATGGCGCCCCGAACCCTCCTCCTGCTACTCTTGGGGGCCCTGGCCCTGACCCAGACCTGGGCGGGCTCCCA
CTCCATGAGGTATTTCACCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCAGGAGAGG
CCTGAGTATTGGGACCAGGAGACACGGAATGTGAAGGCCCACTCACAGATTGACCGAGTGGACCTGGGGACCCTGCGCGG
CTACTACAACCAGAGCGAGGCCGGTTCTCACACCATCCAGATGATGTATGGCTGCGACGTGGGGTCGGACGGGCGCTTCC
TCCGCGGGTACCAGCAGGACGCCTACGACGGCAAGGATTACATCGCCTTGAACGAGGACCTGCGCTCTTGGACCGCGGCG
GACATGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGTTGAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGGACCCCCCCCAAGACGCATATG
ACTCACCACGCTGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGAGCTTCTACCCTGCGGAGATCACACTGAC
CTGGCAGCGGGATGGGGAGGACCAGACCCAGGACACGGAGCTCGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGA
AGTGGGCGTCTGTGGTGGTGCCTTCTGGACAGGAGCAGAGATACACCTGCCATGTGCAGCATGAGGGTCTCCCCAAGCCC
CTCACCCTGAGATGGGAGCCGTCTTCCCAGCCCACCATCCCCATCGTGGGCATCATTGCTGGCCTAGTTCTCTTTGGAGC
TGTGTTCGCTGGAGCTGTGGTCGCTGCTGTGAGGTGGAGGAGGAAGAGCTCAGATAGAAAAGGAGGGAGCTACTCTCAGG
CTGCAAGCAGTGACAGTGCCCAGGGCTCTGATATGTCTCTCACAGCTTGTAAAGTGTGA
Genomic Sequence Data (3090 bps)
ATGGCCGTCATGGCGCCCCGAACCCTCCTCCTGCTACTCTTGGGGGCCCTGGCCCTGACCCAGACCTGGGCGGGTGAGTG
CGGGGTCGTGGGGAAACCGCCTCTGCGGGGAGAAGCAAGGGGCCCGCCCGGCGGGGGCGCAGGACCCGGGTAGCCGCGCC
GGGAGGAGGGTCGGGCGGATCTCAGCCACTCCTCGCCCCCAGGCTCCCACTCCATGAGGTATTTCACCACATCCGTGTCC
CGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTACGTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGC
CGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCAGGAGAGGCCTGAGTATTGGGACCAGGAGACACGGAATG
TGAAGGCCCACTCACAGATTGACCGAGTGGACCTGGGGACCCTGCGCGGCTACTACAACCAGAGCGAGGCCGGTGAGTGA
CCCCAGCCCGGGGCGCAGGTCACGACCTCTCATCCCCCACGGACGGGCCAGGTCACCCACAGTCTCCGGGTCCGAGATCC
ACCCCGAAGCCGCGGGACCCCGAGACCCTTGCCCCGGGAGAGGCCCAGGCGCCTTTACCCGGTTTCATTTTCAGTTTAGG
CCAAAAATCCCCCCGGGTTGGTCGGGGCCGGACGGGGCTCGGGGGACTGGGCTGACCGTGGGGTCGGGGCCAGGTTCTCA
CACCATCCAGATGATGTATGGCTGCGACGTGGGGTCGGACGGGCGCTTCCTCCGCGGGTACCAGCAGGACGCCTACGACG
GCAAGGATTACATCGCCTTGAACGAGGACCTGCGCTCTTGGACCGCGGCGGACATGGCGGCTCAGATCACCCAGCGCAAG
TGGGAGGCGGCCCGTGTGGCGGAGCAGTTGAGAGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGA
GAACGGGAAGGAGACGCTGCAGCGCACGGGTACCAGGGGCCACGGGGCGCCTCCCTGATCGCCTGTAGATCTCCCGGGCT
GGCCTCCCACAAGGAGGGGAGACAATTGGGACCAACACTAGAATATCACCCTCCCTCTGGTCCTGAGGGAGAGGAATCCT
CCTGGGTTTCCAGATCCTGTACCAGAGAGTGACTCTGAGGTTCCGCCCTGCTCTGTGACACAATTAAGGGATAAAATCTC
TGAAGGAATGACGGGAAGACGATCCCTCGAATACTGATGAGTGGTTCCCTTTGACACACACCGGCAGCAGCCTTGGGCCC
GTGACTTTTCCTCTCAGGCCTTGTTCTCTGCTTCACACTCAATGTGTGTGGGGGTCTGAGTCCAGCACTTCTGAGTCCCT
CAGCCTCCACTCAGGTCAGGACCAGAAGTCGCTGTTCCCTCTTCAGGGACTAGAATTTTCCACGGAATAGGAGATTATCC
CAGGTGCCTGTGTCCAGGCTGGTGTCTGGGTTCTGTGCTCCCTTCCCCATCCCAGGTGTCCTGTCCATTCTCAAGATAGC
CACATGTGTGCTGGAGGAGTGTCCCATTACAGATGCAAAATGCCTGAATGTTCTGACTCTTCCTGACAGACCCCCCCCAA
GACGCATATGACTCACCACGCTGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGAGCTTCTACCCTGCGGAGA
TCACACTGACCTGGCAGCGGGATGGGGAGGACCAGACCCAGGACACGGAGCTCGTGGAGACCAGGCCTGCAGGGGATGGA
ACCTTCCAGAAGTGGGCGTCTGTGGTGGTGCCTTCTGGACAGGAGCAGAGATACACCTGCCATGTGCAGCATGAGGGTCT
CCCCAAGCCCCTCACCCTGAGATGGGGTAAGGAGGGAGATGGGGGTGTCATGTCTTTTAGGGAAAGCAGGAGCCTCTCTG
ACCTTTAGCAGGGTCAGGGCCCCTCACCTTCCCCTCTTTTCCCAGAGCCGTCTTCCCAGCCCACCATCCCCATCGTGGGC
ATCATTGCTGGCCTAGTTCTCTTTGGAGCTGTGTTCGCTGGAGCTGTGGTCGCTGCTGTGAGGTGGAGGAGGAAGAGCTC
AGGTGGGGTGAAGGGGTGAAGGGTGGGTCTGAGATTTCTTGTCTCACTGAGGGTTCCAAGACCCAGGTAGAAGTGTGCCC
TGCCTCGTTACTGGGAAGCACCATCCACAATTATGGGCCTACCCAGCCTGGGCCCTGTGTGCCAGCACTTACTCTTTTGT
AAAGCACCTGTTAAAATGAAGGACAGATTTATCACCTTGATTATGGCGGTGATGGGACCTGATCCCAGCAGTCACAAGTC
ACAGGGGAAGGTCCCTGAGGACCTTCAGGAGGGCGGTTGGTCCAGGACCCACACCTGCTTTCTTCATGTTTCCTGATCCC
GCCCTGGGTCTGCAGTCACACATTTCTGGAAACTTCTCTGAGGTCCAAGACTTGGAGGTTCCTCTAGGACCTTAAGGCCC
TGGCTCCTTTCTGGTATCTCACAGGACATTTTCTTCCCACAGATAGAAAAGGAGGGAGCTACTCTCAGGCTGCAAGTAAG
TATGAAGGAGGATGATCCAAGAAATCACTGGGATATTGTGTTTGGGAGCCCGTGGGGGAGCTCACCCACCCCACAATTCC
TCCTCTAGCCACATCTTCTGTGGGATCTGACCAGGTTCTGTTTTTGTCCTACCCCAGGCAGTGACAGTGCCCAGGGCTCT
GATATGTCTCTCACAGCTTGTAAAGGTGAGAGCCTGGAGGGCCTGATGTGTGTTGGGTGTTGGGCGGAACAGTGGACGCA
GCTGTGCTATGGGGTTTCTTTGCATTGGATGTATTGAGCATGCGATGGGCTGTTTAAAGTGTGACTCCTCACTGTGACAG
ATACGAATTTGTTCATGAATATTTTTTTCTATAGTGTGAGACAGCTGCCTTGTGTGGGACTGAGAGGCAAGATTTGTTCC
TGCCCTTCCCTTTGTGACTTGAAGTACCCTGACTTTGTTTCTGCAAAGGCACCTGCATGTGTCTGTGTTCTTGTAGGCAT
AATGTGAGGAGGTGGGGAGACCACCCCACCCCCATGTCCACCATGACCCT

IMGT/HLA

Sponsors

Animated Sponsors Logo