Allele Report for A*30:78N

A*30:78N View HGVS Report
Pre-2010 Nomenclature: Local Names: BY01022
IMGT/HLA Acc No: HLA09705 OMIM Entry: *142800
Assigned: 2013-05-29 Sequence Last Modified: 2013-07-12
Source Entries: KF028619  
Cells Sequence Derived From: BY01022  
Known Ethnic Origin Of Source: Black
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (51 aa)
SHSMRYFSTSVSRPGSGEPRFIAVGYVDDTQFVRFDSAPRARGWSRGRRGX
Nucleotide Sequence Data (545 bps)
GCTCCCACTCCATGAGGTATTTCTCCACATCCGTGTCCCGGCCCGGCAGTGGAGAGCCCCGCTTCATCGCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGCGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCAG
GAGAGGCCTGAGTATTGGGACCAGGAGACACGGAATGTGAAGGCCCAGTCACAGACTGACCGAGTGGACCTGGGGACCCT
GCGCGGCTACTACAACCAGAGCGAGGCCGGTTCTCACACCATCCAGATAATGTATGGCTGCGACGTGGGGTCGGACGGGC
GCTTCCTCCGCGGGTATGAACAGCACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCTTGGACC
GCGGCGGACATGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTTGGGCGGAGCAGTTGAGAGCCTACCTGGA
GGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo