Allele Report for A*30:11:02

A*30:11:02 View HGVS Report
Pre-2010 Nomenclature: A*301102 Local Names: A*3021, BY00146
IMGT/HLA Acc No: HLA03102 OMIM Entry: *142800
Assigned: 2007-08-31 Sequence Last Modified: 2007-10-05
Source Entries: EF422076  
Cells Sequence Derived From: BY00146  
Known Ethnic Origin Of Source: Oriental
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: A30 WHO Assigned Type: A30(19)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) - -
Neural Network Assigned Type: A30
Comments:
Protein Sequence (181 aa)
SHSMRYFSTSVSRPGSGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTL
RGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYEQHAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARWAEQLRAYLE
GTCVEWLRRYLENGKETLQRT
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTCCACATCCGTGTCCCGGCCCGGCAGTGGAGAGCCCCGCTTCATCGCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCTGAGTATTGGGACCAGGAGACACGGAATGTGAAGGCCCAGTCACAGACTGACCGAGTGGACCTGGGGACCC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGTTCTCACACCATCCAGATAATGTATGGCTGCGACGTGGGGTCGGACGGG
CGCTTCCTCCGCGGGTATGAACAGCACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCTTGGAC
CGCGGCGGACATGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTTGGGCGGAGCAGTTGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo