Allele Report for A*29:55

A*29:55 View HGVS Report
Pre-2010 Nomenclature: Local Names: HLA-A*29:var
IMGT/HLA Acc No: HLA09824 OMIM Entry: *142800
Assigned: 2013-06-26 Sequence Last Modified: 2013-07-12
Source Entries: KF152915 , KF415247  
Cells Sequence Derived From: 13210187 , HG00007152  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDLQTRNVKAQSQTDRANLGTL
SGYYNQSEAGSHTIQMMYGCHVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLE
GTCVEWLRRYLENGKETLQRT
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCACCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTTGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCACCGTGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCTGCAGACACGGAATGTGAAGGCCCAGTCACAGACTGACCGAGCGAACCTGGGGACCC
TGAGCGGCTACTACAACCAGAGCGAGGCCGGTTCTCACACCATCCAGATGATGTATGGCTGCCACGTGGGGTCGGACGGG
CGCTTCCTCCGCGGGTACCGGCAGGACGCCTACGACGGCAAGGATTACATCGCCTTGAACGAGGACCTGCGCTCTTGGAC
CGCGGCGGACATGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGTTGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo