Allele Report for A*29:02:03

A*29:02:03
Pre-2010 Nomenclature: A*290203 Local Names: 218584
IMGT/HLA Acc No: HLA01887 OMIM Entry: *142800
Assigned: 2004-03-22 Sequence Last Modified: 2004-04-05
Source Entries: AJ629870 , AJ629871 , HM363055 , JX101613  
Cells Sequence Derived From: 218584 , BY00687 , MDA0000018  
Known Ethnic Origin Of Source: Hispanic
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 3
HLA Dictionary Data
Expert Assigned Type: A29 WHO Assigned Type: A29(19)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 17 A29 [98-100%]
NMDP (2008) 1488 A29 [99%]
13 IHWC (2002) 28 A29
Neural Network Assigned Type: Training - A29
Comments:
Protein Sequence (181 aa)
SHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDLQTRNVKAQSQTDRANLGTL
RGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLE
GTCVEWLRRYLENGKETLQRT
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCACCACATCCGTCTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTTGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCACCGTGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCTGCAGACACGGAATGTGAAGGCCCAGTCACAGACTGACCGAGCGAACCTGGGGACCC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGTTCTCACACCATCCAGATGATGTATGGCTGCGACGTGGGGTCGGACGGG
CGCTTCCTCCGCGGGTACCGGCAGGACGCCTACGACGGCAAGGATTACATCGCCTTGAACGAGGACCTGCGCTCTTGGAC
CGCGGCGGACATGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGTTGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo