Allele Report for A*29:02:01:01

A*29:02:01:01 View HGVS Report
Pre-2010 Nomenclature: A*290201 Local Names: A29.2
IMGT/HLA Acc No: HLA00086 OMIM Entry: *142800
Assigned: 1991-06-17 Sequence Last Modified: 2008-04-08
Source Entries: AM944568 , CR382333 , X60108  
Cells Sequence Derived From: HSR131658 , LAM , MOU  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Common
Publications
Tabary T et al. C R Acad Sci III 313:599-605 1991. (View abstract)
Heinhold A et al. Tissue Antigens 72:397-400 2008. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 3 Laboratories: 3
HLA Dictionary Data
Expert Assigned Type: A29 WHO Assigned Type: A29(19)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 17 A29 [98-100%]
NMDP (2008) 1488 A29 [99%]
13 IHWC (2002) 28 A29
Neural Network Assigned Type: Training - A29
Comments:
Protein Sequence (365 aa)
MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEG
PEYWDLQTRNVKAQSQTDRANLGTLRGYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAA
DMAAQITQRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRYTCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGA
VFAGAVVAAVRWRRKSSDRKGGSYSQAASSDSAQGSDMSLTACKV
Nucleotide Sequence Data (1098 bps)
ATGGCCGTCATGGCGCCCCGAACCCTCCTCCTGCTACTCTTGGGGGCCCTGGCCCTGACCCAGACCTGGGCGGGCTCCCA
CTCCATGAGGTATTTCACCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTTGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCACCGTGGATAGAGCAGGAGGGG
CCGGAGTATTGGGACCTGCAGACACGGAATGTGAAGGCCCAGTCACAGACTGACCGAGCGAACCTGGGGACCCTGCGCGG
CTACTACAACCAGAGCGAGGCCGGTTCTCACACCATCCAGATGATGTATGGCTGCGACGTGGGGTCGGACGGGCGCTTCC
TCCGCGGGTACCGGCAGGACGCCTACGACGGCAAGGATTACATCGCCTTGAACGAGGACCTGCGCTCTTGGACCGCGGCG
GACATGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGTTGAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGGACGCCCCCAAGACGCATATGA
CTCACCACGCTGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGAGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGGGAGGACCAGACCCAGGACACGGAGCTTGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAA
GTGGGCGTCTGTGGTGGTGCCTTCTGGACAGGAGCAGAGATACACCTGCCATGTGCAGCATGAGGGTCTGCCCAAGCCCC
TCACCCTGAGATGGGAGCCGTCTTCCCAGCCCACCATCCCCATCGTGGGCATCATTGCTGGCCTAGTTCTCTTTGGAGCT
GTGTTCGCTGGAGCTGTGGTCGCTGCTGTGAGGTGGAGGAGGAAGAGCTCAGATAGAAAAGGAGGGAGCTACTCTCAGGC
TGCAAGCAGTGACAGTGCCCAGGGCTCTGATATGTCTCTCACAGCTTGTAAAGTGTGA
Genomic Sequence Data (3518 bps)
CAGGAGCAGAGGGGTCAGGGCGAAGTCCCAGGGCCCCAGGCGTGGCTCTCAGGGTCTCAGGCCCCGAAGGCGGTGTATGG
ATTGGGGAGTCCCAGCCTTGGGGATTCCCCAACTCCGCAGTTTCTTTTCTCCCTCTGCCAACCTATGTAGGGTCCTTCTT
CCTGGATACTCACGACGCGGACCCAGTTCTCACTCCCATTGGGTGTCGGGTTTCCAGAGAAGCCAATCAGTGTCGTCGCG
GTCGCGGTTCTAAAGTCCGCACGCACCCACCGGGACTCAGATTCTCCCCAGACGCCGAGGATGGCCGTCATGGCGCCCCG
AACCCTCCTCCTGCTACTCTTGGGGGCCCTGGCCCTGACCCAGACCTGGGCGGGTGAGTGCGGGGTCGTGGGGAAACCGC
CTCTGCGGGGAGAAGCAAGGGGCCCGCCCGGCGGGGACGCAGGACCCGGGTAGCCGCGCCGGGAGGAGGGTCGGGTGGGT
CTCAGCCACTCCTCGCCCCCAGGCTCCCACTCCATGAGGTATTTCACCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCC
CCGCTTCATCGCCGTGGGCTACGTGGACGACACGCAGTTCGTGCGGTTTGACAGCGACGCCGCGAGCCAGAGGATGGAGC
CGCGGGCACCGTGGATAGAGCAGGAGGGGCCGGAGTATTGGGACCTGCAGACACGGAATGTGAAGGCCCAGTCACAGACT
GACCGAGCGAACCTGGGGACCCTGCGCGGCTACTACAACCAGAGCGAGGCCGGTGAGTGACCCCGGCCCGGGGCGCAGGT
CACGACCTCTCATCCCCCACGGACGGGCCGGGTCGCCCACAGTCTCCGGGTCCGAGATCCACCCCGAAGCCGCGGGACCC
CGAGACCCTTGCCCCGGGAGAGGCCCAGGCGCCTTTACCCGGTTTCATTTTCAGTTTAGGCCAAAAATCCCCCCGGGTTG
GTCGGGGCCGGACGGGGCTCGGGGGACTGGGCTGACCGTGGGGTCGGGGCCAGGTTCTCACACCATCCAGATGATGTATG
GCTGCGACGTGGGGTCGGACGGGCGCTTCCTCCGCGGGTACCGGCAGGACGCCTACGACGGCAAGGATTACATCGCCTTG
AACGAGGACCTGCGCTCTTGGACCGCGGCGGACATGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGC
GGAGCAGTTGAGAGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGC
AGCGCACGGGTACCGGGGGCCACGGGGCGCCTCCCTGATCGCCTGTAGATCTCCCGGGCTGGCCTCCCACAAGGAGGGGA
GACAATTGGGACCAACACTAGAATATCGCCCTCCCTCTGGTCCTGAGGGAGAGGAATCCTCCTGGGTTTCCAGATCCTGT
ACCAGAGAGTGACTCTGAGGTTCCGCCCTGCTCTCTGACACAATTAAGGGATAAAATCTCTGAAGGAATGACGGGAAGAC
GATCCCTCGAATACTGATGAGTGGTTCCCTTTGACACACACCGGCAGCAGCCTTGGGCCCGTGACTTTTCCTCTCAGGCC
TTGTTCTCTGCTTCACACTCAATGTGTGTGGGGGTCTGAGTCCAGCACTTCTGAGTCCCTCAGCCTCCACTCAGGTCAGG
ACCAGAAGTCGCTGTTCCCTCTTCAGGGACTAGAATTTTCCACGGAATAGGAGATTATCCCAGGTGCCTGTGTCCAGGCT
GGTGTCTGGGTTCTGTGCTCCCTTCCCCATCCCAGGTGTCCTGTCCATTCTCAAGATAGCCACATGTGTGCTGGAGGAGT
GTCCCATGACAGATGCAAAATGCCTGAATGTTCTGACTCTTCCTGACAGACGCCCCCAAGACGCATATGACTCACCACGC
TGTCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGAGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGG
ATGGGGAGGACCAGACCCAGGACACGGAGCTTGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAAGTGGGCGTCT
GTGGTGGTGCCTTCTGGACAGGAGCAGAGATACACCTGCCATGTGCAGCATGAGGGTCTGCCCAAGCCCCTCACCCTGAG
ATGGGGTAAGGAGGGAGATGGGGGTGTCATGTCTTTTAGGGAAAGCAGGAGCCTCTCTGACCTTTAGCAGGGTCAGGGCC
CCTCACCTTCCCCTCTTTTCCCAGAGCCGTCTTCCCAGCCCACCATCCCCATCGTGGGCATCATTGCTGGCCTAGTTCTC
TTTGGAGCTGTGTTCGCTGGAGCTGTGGTCGCTGCTGTGAGGTGGAGGAGGAAGAGCTCAGGTGGGGTGAAGGGATGAAG
GGTGGGTCTGAGATTTCTTGTCTCACTGAGGGTTCCAAGACCCAGGTAGAAGTGTGCCCTGCCTCGTTACTGGGAAGCAC
CATCCACAATTATGGGCCTACCCAGCCTGGGCCCTGTGTGCCAGCACTTACTCTTTTGTAAAGCACCTGTTAAAATGAAG
GACAGATTTATCACCTTGATTACGGCGGTGATGGGACCTGATCCCAGCAGTCACAAGTCACAGGGGAAGGTCCCTGAGGA
CCTTCAGGAGGGCGGTTGGTCCAGGACCCACACCTGCTTTCTTCATGTTTCCTGATCCCGCCCTGGGTCTGCAGTCACAC
ATTTCTGGAAACTTCTCTGAGGTCCAAGACTTGGAGGTTCCTCTAGGACCTTAAGGCCCTGGCTCCTTTCTGGTATCTCA
CAGGACATTTTCTTCCCACAGATAGAAAAGGAGGGAGCTACTCTCAGGCTGCAAGTAAGTATGAAGGAGGCTGATGCCTG
AGGTCCTTGGGATATTGTGTTTGGGAGCCCGTGGGGGAGCTCACCCACCCCACAATTCCTCCTCTAGCCACATCTTCTGT
GGGATCTGACCAGGTTCTGTTTTTGTCCTACCCCAGGCAGTGACAGTGCCCAGGGCTCTGATATGTCTCTCACAGCTTGT
AAAGGTGAGAGCCTGGAGGGCCTGATGTGTGTTGGGTGTTGGGCGGAACAGTGGACGCAGCTGTGCTATGGGGTTTCTTT
GCATTGGATGTATTGAGCATGCGATGGGCTGTTTAAAGTGTGACTCCTCACTGTGACAGATACGAATTTGTTCATGAATA
TTTTTTTCTATAGTGTGAGACAGCTGCCTTGTGTGGGACTGAGAGGCAAGATTTGTTCCTGCCCTTCCCTTTGTGACTTG
AAGAACCCTGACTTTGTTTCTGCAAAGGCACCTGCATGTGTCTGTGTTCTTGTAGGCATAATGTGAGGAGGTGGGGAGAC
CACCCCACCCCCATGTCCACCATGACCCTCTTCCCACGCTGACCTGTGCTCCCTCCCCAATCATCTTTCCTGTTCCAGAG
AGGTGGGGCTGAGGTGTCTCCATCTCTGCCTCAACTTCATGGTGCACTGAGCTGTAACTTCTTCCTTCCCTATTAAAA

IMGT/HLA

Sponsors

Animated Sponsors Logo