Allele Report for A*25:24

A*25:24 View HGVS Report
Pre-2010 Nomenclature: Local Names: BY01168
IMGT/HLA Acc No: HLA10524 OMIM Entry: *142800
Assigned: 2013-10-31 Sequence Last Modified: 2014-01-17
Source Entries: KF381219 , KF649124  
Cells Sequence Derived From: BY01168  , HG00007164  
Known Ethnic Origin Of Source: Oriental
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAHSQTDPESLRIA
LRYYNQSEDGSHTIQRMYGCDVGPDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWETAHEAEQWRAYLE
GRCVEWLRRYLENGKETLQRT
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCGGAACACACGGAATGTGAAGGCCCACTCACAGACTGACCCAGAGAGCCTGCGGATCG
CGCTCCGCTACTACAACCAGAGCGAGGACGGTTCTCACACCATCCAGAGGATGTATGGCTGCGACGTGGGGCCGGACGGG
CGCTTCCTCCGCGGGTACCAGCAGGACGCTTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCTTGGAC
CGCGGCGGACATGGCGGCTCAGATCACCCAGCGCAAGTGGGAGACGGCCCATGAGGCGGAGCAGTGGAGAGCCTACCTGG
AGGGCCGGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo