Allele Report for A*24:110

A*24:110 View HGVS Report
Pre-2010 Nomenclature: Local Names: HistoGenetics HIS_NEW_A_334_00474, HIS_NEW_A_334_00466, HIS_NEW_A_334_00467, DE HIS_NEW_A_334_00468, HIS_NEW_A_385_00623
IMGT/HLA Acc No: HLA04908 OMIM Entry: *142800
Assigned: 2010-04-30 Sequence Last Modified: 2010-07-16
Source Entries: FJ619397 , FJ619398 , FJ619399 , FJ619405 , FJ797945 , GQ149260 , GQ149280 , JN123758 , JN124034 , JN124062  
Cells Sequence Derived From: HG00000561 , HG00002312 , HG00002313 , HG00002752 , HN-28167-6 , HN-28293-9 , HN-33925-8 , HN-34936-4 , HN-69384-5 , HN-69778-5  
Known Ethnic Origin Of Source: Unknown
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 10 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIA
LRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIAVKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLE
GTCVDGLRRYLENGKETLQRT
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTCCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACGAGGAGACAGGGAAAGTGAAGGCCCACTCACAGACTGACCGAGAGAACCTGCGGATCG
CGCTCCGCTACTACAACCAGAGCGAGGCCGGTTCTCACACCCTCCAGATGATGTTTGGCTGCGACGTGGGGTCGGACGGG
CGCTTCCTCCGCGGGTACCACCAGTACGCCTACGACGGCAAGGATTACATCGCCGTGAAAGAGGACCTGCGCTCTTGGAC
CGCGGCGGACATGGCGGCTCAGATCACCAAGCGCAAGTGGGAGGCGGCCCATGTGGCGGAGCAGCAGAGAGCCTACCTGG
AGGGCACGTGCGTGGACGGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo