Allele Report for A*24:70

A*24:70 View HGVS Report
Pre-2010 Nomenclature: A*2470 Local Names: A*24MHA1106
IMGT/HLA Acc No: HLA02777 OMIM Entry: *142800
Assigned: 2007-01-28 Sequence Last Modified: 2007-04-12
Source Entries: AM411623 , GQ149284  
Cells Sequence Derived From: HN-B-174698 , MHHAKB-206446  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: A24 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) - -
Neural Network Assigned Type: A24
Comments:
Protein Sequence (181 aa)
SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIA
LRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGRDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLE
GTCVDGLRRYLENGKETLQRT
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTCCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACGAGGAGACAGGGAAAGTGAAGGCCCACTCACAGACTGACCGAGAGAACCTGCGGATCG
CGCTCCGCTACTACAACCAGAGCGAGGCCGGTTCTCACACCCTCCAGATGATGTTTGGCTGCGACGTGGGGTCGGACGGG
CGCTTCCTCCGCGGGTACCACCAGTACGCCTACGACGGCAGGGATTACATCGCCCTGAAAGAGGACCTGCGCTCTTGGAC
CGCGGCGGACATGGCGGCTCAGATCACCAAGCGCAAGTGGGAGGCGGCCCATGTGGCGGAGCAGCAGAGAGCCTACCTGG
AGGGCACGTGCGTGGACGGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo