Allele Report for A*24:39

A*24:39 View HGVS Report
Pre-2010 Nomenclature: A*2439 Local Names: FHNG
IMGT/HLA Acc No: HLA01773 OMIM Entry: *142800
Assigned: 2003-07-31 Sequence Last Modified: 2003-10-15
Source Entries: AH010624 , AY028635 , AY028636 , AY028637  
Cells Sequence Derived From: FHNG , FHPK  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: A24 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) - -
Neural Network Assigned Type: A24
Comments:
Protein Sequence (273 aa)
SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIA
LRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYYGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLE
GTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTF
QKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Nucleotide Sequence Data (822 bps)
GCTCCCACTCCATGAGGTATTTCTCCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACGAGGAGACAGGGAAAGTGAAGGCCCACTCACAGACTGACCGAGAGAACCTGCGGATCG
CGCTCCGCTACTACAACCAGAGCGAGGCCGGTTCTCACACCCTCCAGATGATGTTTGGCTGCGACGTGGGGTCGGACGGG
CGCTTCCTCCGCGGGTACCACCAGTACGCCTACTACGGCAAGGATTACATCGCCCTGAAAGAGGACCTGCGCTCTTGGAC
CGCGGCGGACATGGCGGCTCAGATCACCAAGCGCAAGTGGGAGGCGGCCCATGTGGCGGAGCAGCAGAGAGCCTACCTGG
AGGGCACGTGCGTGGACGGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGGACCCCCCCAAGACA
CATATGACCCACCACCCCATCTCTGACCATGAGGCCACTCTGAGATGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCAC
ACTGACCTGGCAGCGGGATGGGGAGGACCAGACCCAGGACACGGAGCTTGTGGAGACCAGGCCTGCAGGGGATGGAACCT
TCCAGAAGTGGGCAGCTGTGGTGGTACCTTCTGGAGAGGAGCAGAGATACACCTGCCATGTGCAGCATGAGGGTCTGCCC
AAGCCCCTCACCCTGAGATGGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo