Allele Report for A*24:02:19

A*24:02:19
Pre-2010 Nomenclature: A*240219 Local Names: HistoGenetics HIS_NEW_A_334_00490
IMGT/HLA Acc No: HLA03741 OMIM Entry: *142800
Assigned: 2009-03-31 Sequence Last Modified: 2009-10-19
Source Entries: FJ224169 , FJ224214 , FJ224233 , FJ224243 , FJ619393 , FJ619402 , FJ619420 , FJ619421 , FJ619464 , FJ619471 , FJ797948 , FJ875543 , GQ149259 , GQ149288 , GQ240537 , GQ240544 , GQ859502 , GQ859518  
Cells Sequence Derived From: HN-07579-9 , HN-07962-6 , HN-14637-8 , HN-17031-3 , HN-19680-2 , HN-22305-5 , HN-29993-5 , HN-3321372 , HN-34236-8 , HN-4246661 , HN-56961-5 , HN-7003269 , HN-77073-5 , HN-78007-2 , HN-78059-1 , HN-86540-2 , HN-91110-0 , HN-97781-6  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 18 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIA
LRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLE
GTCVDGLRRYLENGKETLQRT
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTCCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCCGAGTATTGGGACGAGGAGACAGGGAAAGTGAAGGCCCACTCACAGACTGACCGAGAGAACCTGCGGATCG
CGCTCCGCTACTACAACCAGAGCGAGGCCGGTTCTCACACCCTCCAGATGATGTTTGGCTGCGACGTGGGGTCGGACGGG
CGCTTCCTCCGCGGGTACCACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAAAGAGGACCTGCGCTCTTGGAC
CGCGGCGGACATGGCGGCTCAGATCACCAAGCGCAAGTGGGAGGCGGCCCATGTGGCGGAGCAGCAGAGAGCCTACCTGG
AGGGCACGTGCGTGGACGGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo