Allele Report for A*24:02:08

A*24:02:08 View HGVS Report
Pre-2010 Nomenclature: A*240208 Local Names: BY00060
IMGT/HLA Acc No: HLA02299 OMIM Entry: *142800
Assigned: 2005-07-28 Sequence Last Modified: 2005-10-07
Source Entries: AH015055 , DQ105564 , DQ105565  
Cells Sequence Derived From: BY00060  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
Publications
Tang TF et al. Tissue Antigens 68:518-20 2006. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: A24 WHO Assigned Type: A24(9)
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 99 A24 [97-100%]
NMDP (2008) 3098 A24 [97%] A2403 [1%]
13 IHWC (2002) 146 A24
Neural Network Assigned Type: Training - A9 A24
Comments:
Protein Sequence (181 aa)
SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIA
LRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLE
GTCVDGLRRYLENGKETLQRT
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTCCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACGAGGAGACAGGGAAAGTGAAGGCCCACTCACAGACTGACCGAGAGAACCTGCGGATCG
CGCTCCGCTACTACAACCAGAGCGAGGCCGGTTCTCACACCCTCCAGATGATGTTTGGCTGCGACGTGGGGTCGGACGGG
CGCTTCCTCCGCGGGTACCACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAAAGAGGACCTGCGCTCTTGGAC
CGCGGCGGACATGGCGGCTCAGATCACCAAGCGCAAGTGGGAGGCGGCCCACGTGGCGGAGCAGCAGAGAGCCTACCTGG
AGGGCACGTGCGTGGACGGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo