Allele Report for A*23:19Q

A*23:19Q View HGVS Report
Pre-2010 Nomenclature: A*2319Q Local Names: A23var
IMGT/HLA Acc No: HLA03183 OMIM Entry: *142800
Assigned: 2007-12-20 Sequence Last Modified: 2008-01-11
Source Entries: AH015159 , DQ145282 , DQ145283 , EF656476 , FJ875682 , GQ132036 , GQ149261 , GQ149268 , JQ793890  
Cells Sequence Derived From: 95230 , ALX0010 , HG00000366 , HG00000367 , HN-0242425 , HN-7579920 , MDA0000002  
Known Ethnic Origin Of Source: Black, Caucasoid
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 7 Laboratories: 4
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (273 aa)
SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIA
LRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLE
GTCVDGLRRYLENGKETLQRTNPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTF
QKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Nucleotide Sequence Data (822 bps)
GCTCCCACTCCATGAGGTATTTCTCCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACGAGGAGACAGGGAAAGTGAAGGCCCACTCACAGACTGACCGAGAGAACCTGCGGATCG
CGCTCCGCTACTACAACCAGAGCGAGGCCGGTTCTCACACCCTCCAGATGATGTTTGGCTGCGACGTGGGGTCGGACGGG
CGCTTCCTCCGCGGGTACCACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAAAGAGGACCTGCGCTCTTGGAC
CGCGGCGGACATGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGTTGAGAGCCTACCTGG
AGGGCACGTGCGTGGACGGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGAACCCCCCCAAGACA
CATATGACCCACCACCCCATCTCTGACCATGAGGCCACTCTGAGATGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCAC
ACTGACCTGGCAGCGGGATGGGGAGGACCAGACCCAGGACACGGAGCTTGTGGAGACCAGGCCTGCAGGGGATGGAACCT
TCCAGAAGTGGGCAGCTGTGGTGGTACCTTCTGGAGAGGAGCAGAGATACACCTGCCATGTGCAGCATGAGGGTCTGCCC
AAGCCCCTCACCCTGAGATGGG
Genomic Sequence Data (2830 bps)
GTGTCGTCGCGGTCGCTGTTCTAAAGTCCGCACGCACCCACCGGGACTCAGATTCTCCCCAGACGCCGAGGGTGAGTGCG
GGGTCGGGAGGGAAACGGCCTCTGCGGGGAGAAGCAAGGGGCCCGCCTGGCGGGGGCGCAAGACCCGGGAAGCCGCGCCG
GGAGGAGGGTCGGGCGGGTCTCAGCCACTCCTCGTCCCCAGGCTCCCACTCCATGAGGTATTTCTCCACATCCGTGTCCC
GGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTACGTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCC
GCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCAGGAGGGGCCGGAGTATTGGGACGAGGAGACAGGGAAAGT
GAAGGCCCACTCACAGACTGACCGAGAGAACCTGCGGATCGCGCTCCGCTACTACAACCAGAGCGAGGCCGGTGAGTGAC
CCCGGCCCGGGGCGCAGGTCACGACCCCTCATCCCCCACGGACGGGCCGGGTCGCCCACAGTCTCCGGGTCCGAGATCCA
CCCCGAAGCCGCGGGACCCCGAGACCCTTGCCCCGGGAGAGGCCCAGGCGCCTTAACCCGGTTTCATTTTCAGTTTAGGC
CAAAAATCCCCCCGGGTTGGTCGGGGCCGGGCGGGGCTCGGGGGACTGGGCTGACCGCGGGGTCGGGGCCAGGTTCTCAC
ACCCTCCAGATGATGTTTGGCTGCGACGTGGGGTCGGACGGGCGCTTCCTCCGCGGGTACCACCAGTACGCCTACGACGG
CAAGGATTACATCGCCCTGAAAGAGGACCTGCGCTCTTGGACCGCGGCGGACATGGCGGCTCAGATCACCCAGCGCAAGT
GGGAGGCGGCCCGTGTGGCGGAGCAGTTGAGAGCCTACCTGGAGGGCACGTGCGTGGACGGGCTCCGCAGATACCTGGAG
AACGGGAAGGAGACGCTGCAGCGCACGAGTACCAGGGGCCACGGGGCGCCTACCTGATCGCCTGTAGGTCTCCCGGGCTG
GCCTCCCACAAGGAGGGGAGACAATTGGGACCAACACTAGAATATCGCCCTCCCTCTGGTCCTGAGGGAGAGGAATCCTC
CTGGGTTTCCAGATCCTGTACCAGAGAGTGACTCTGAGGTTCCGCCCTGCTCTCTGACACAATTAAGGGATAAAATCTCT
GACGGAATGACGGAAAGACGATCCCTCGAATACTGATGACTGGTTCCCTTTGACACCGGCAGCAGCCTTGGGACCGTGAC
TTTTCCTCTCAGGCCTTGTTCTCTGCTTCACACTCAATGTGTGTGGGGGTCTGAGTCCAGCACTTCTGAGTCCCTCAGCC
TCCACTCAGGTCAGGACCAGAAGTCGCTGTTCCCTCCTCAGGGAATAGAAGATTATCCCAGGTGCCTGTGTCCAGGCTGG
TGTCTGGGTTCTGTGCTCTCTTCCCCATCCCGGGTGTCCTGTCCATTCTCAAGATGGCCACATGCATGCTGGTGGAGTGT
CCCATGACAGATGCAAAATGCCTGAATTTTCTGACTCTTCCCGTCAGACCCCCCCAAGACACATATGACCCACCACCCCA
TCTCTGACCATGAGGCCACTCTGAGATGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGAT
GGGGAGGACCAGACCCAGGACACGGAGCTTGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAAGTGGGCAGCTGT
GGTGGTACCTTCTGGAGAGGAGCAGAGATACACCTGCCATGTGCAGCATGAGGGTCTGCCCAAGCCCCTCACCCTGAGAT
GGGGTAAGGAGGGAGATGGGGGTGTCATGTCTCTTAGGGAAAGCAGGAGCCTCTCTGGAGACCTTTAGCAGGGTCAGGGC
CCCTCACCTTCCCCTCTTTTCCCAGGTGGAGAAGGGGTGAAGGGTGGGGTCTGAGATTTCTTGTCTCACTGAGGGTTCCA
AGCCCCAGCTAGAAATGTGCCCTGTCTCATTACTGGGAAGCACCATCCACAATCATGGGCCGACCCAGCCTGGGCCCTGT
GTGCCAGCACTTACTCTTTTGTAAAGCACCTGTGACAATGAAGGACAGATTTATCACCTTGATTATGGCGGTGATGGGAC
CTGATCCCAGCAGTCACAAGTCACAGGGGAAGGTCCCTGACGACAGATCTCAGGAGGGCGATTGGTCCAGGGCCCACATC
TGCTTTCTTCATGTTTCCTGATCCTGCCCTGGGTCTGCAGTCACACATTTCTGGAAACTTCTCTGGGGTCCAAGACTAGG
AGGTTCCTCTAGGACCTTAAGGCCCTGGCTCCTTTCTGGTATCTCACAGGACATTTTCTTCCCACAGGTAAGTATGAAGG
AGGCTGATGCCTGAGGTCCTTGGGATATTGTGTTTGGGAGCCCATGGGGGAGCTCAACCACCCCACAATTCCTCCTCTAG
CCACATCTTCTGTGGGATCTGACCAGGTTCTGTTTTTGTTCTACCCCAGGTGAGAGCTTGGAGGGCCTGATGTGTGTTGG
GTGTTGGGCGGAACAGTGGACACAGCTGTGCTATGGGGTTTCTTTGCATTGGATGTATTGAGCATGCGATGGGCTGTTTA
AAGTGTGACCCCTCACTGTGACAGATATGAAGTTGTTCATGAATTTTTTTTCTATAGGACAGCTGCCTTGTGTGGGACTG
AGAGGCAAGAGTTGTTCCTGCCCTTCCCTTTGTGACTTGAAGAACCCTGACTTTGTTTCTGCAAAGGCACCTGCATGTGT
CTGTGTTCATGTAGGCATAATGTGAGGAGA

IMGT/HLA

Sponsors

Animated Sponsors Logo