Allele Report for A*23:01:02

A*23:01:02 View HGVS Report
Pre-2010 Nomenclature: A*230102 Local Names: HistoGenetics HIS_NEW_A_192_00087, HIS_NEW_A_330_00451, HIS_NEW_A_330_00452
IMGT/HLA Acc No: HLA03788 OMIM Entry: *142800
Assigned: 2009-04-30 Sequence Last Modified: 2009-10-19
Source Entries: FJ224143 , FJ224186 , FJ600633 , FJ600646 , FJ600647 , FJ619403 , FJ619408 , FJ619415 , FJ640589 , FJ792526 , FJ907383 , FJ952580 , GQ149250 , GQ149297 , GQ245714 , GQ449619 , GQ994050 , GQ994054  
Cells Sequence Derived From: HN-03764-4 , HN-06561-7 , HN-07940-9 , HN-1352361 , HN-23088-9 , HN-24793-3 , HN-25543-9 , HN-28515-4 , HN-36828-9 , HN-40389-1 , HN-46329-8 , HN-52147-3 , HN-57136-6 , HN-57799-4 , HN-61311-1 , HN-76176-8 , HN-86322-2 , HN-98551-2  
Known Ethnic Origin Of Source: Unknown
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 18 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIA
LRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLE
GTCVDGLRRYLENGKETLQRT
Nucleotide Sequence Data (546 bps)
GCTCCCATTCCATGAGGTATTTCTCCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACGAGGAGACAGGGAAAGTGAAGGCCCACTCACAGACTGACCGAGAGAACCTGCGGATCG
CGCTCCGCTACTACAACCAGAGCGAGGCCGGTTCTCACACCCTCCAGATGATGTTTGGCTGCGACGTGGGGTCGGACGGG
CGCTTCCTCCGCGGGTACCACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAAAGAGGACCTGCGCTCTTGGAC
CGCGGCGGACATGGCGGCTCAGATCACCCAGCGCAAGTGGGAGGCGGCCCGTGTGGCGGAGCAGTTGAGAGCCTACCTGG
AGGGCACGTGCGTGGACGGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo