Allele Report for A*11:58

A*11:58
Pre-2010 Nomenclature: A*1158 Local Names: HIS_NEW_A_436_00687, HIS_NEW_A_476_00851
IMGT/HLA Acc No: HLA04772 OMIM Entry: *142800
Assigned: 2010-02-22 Sequence Last Modified: 2010-04-01
Source Entries: FJ875688 , FJ976761 , GQ132027 , GQ199661 , HM594744 , JN124107 , JN124108 , JN124110 , JN124114 , JQ824425  
Cells Sequence Derived From: HG00000133 , HG00000134 , HG00002948 , HG00002949 , HG00002950 , HG00002951 , HG00004881 , HN-1253498 , HN-3358731 , HN-5708180  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 10 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFYTSVSRPGRGEPRFIAAGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTL
RGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHAAEQQRAYLE
GRCVEWLRRYLENGKETLQRT
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGCGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCAGGAGACACGGAATGTGAAGGCCCAGTCACAGACTGACCGAGTGGACCTGGGGACCC
TGCGCGGCTACTACAACCAGAGCGAGGACGGTTCTCACACCATCCAGATAATGTATGGCTGCGACGTGGGGCCGGACGGG
CGCTTCCTCCGCGGGTACCGGCAGGACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCTTGGAC
CGCGGCGGACATGGCAGCTCAGATCACCAAGCGCAAGTGGGAGGCGGCCCATGCGGCGGAGCAGCAGAGAGCCTACCTGG
AGGGCCGGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo