Allele Report for A*11:131

A*11:131
Pre-2010 Nomenclature: Local Names: HIS_NEW_A_110289_100000
IMGT/HLA Acc No: HLA08614 OMIM Entry: *142800
Assigned: 2012-09-30 Sequence Last Modified: 2012-10-17
Source Entries: JX290325 , KF471685 , KF471687 , KF471691 , KF471692 , KF471693 , KF471698 , KF471699 , KF471700 , KF471701 , KF471703 , KF471705 , KF471707 , KF471710 , KF471711 , KF471712 , KF471713 , KF471714 , KF471715 , KF501498  
Cells Sequence Derived From: HG00004504 , HG00007536 , HG00007537 , HG00007538 , HG00007539 , HG00007540 , HG00007541 , HG00007542 , HG00007543 , HG00007544 , HG00007545 , HG00007546 , HG00007547 , HG00007548 , HG00007549 , HG00007550 , HG00007551 , HG00007552 , HG00007553 , HG00007554  
Known Ethnic Origin Of Source: Unknown
Publications
Unpublished
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 20 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPKYWDQETRNVKAQSQTDRVDLGTL
RGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHAAEQQRAYLE
GRCVEWLRRYLENGKETLQRT
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGAAGTATTGGGACCAGGAGACACGGAATGTGAAGGCCCAGTCACAGACTGACCGAGTGGACCTGGGGACCC
TGCGCGGCTACTACAACCAGAGCGAGGACGGTTCTCACACCATCCAGATAATGTATGGCTGCGACGTGGGGCCGGACGGG
CGCTTCCTCCGCGGGTACCGGCAGGACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCTTGGAC
CGCGGCGGACATGGCAGCTCAGATCACCAAGCGCAAGTGGGAGGCGGCCCATGCGGCGGAGCAGCAGAGAGCCTACCTGG
AGGGCCGGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo