Allele Report for A*11:127N

A*11:127N View HGVS Report
Pre-2010 Nomenclature: Local Names: A*11
IMGT/HLA Acc No: HLA08109 OMIM Entry: *142800
Assigned: 2012-05-22 Sequence Last Modified: 2012-07-12
Source Entries: JX013637  
Cells Sequence Derived From: 0100270  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
Publications
Lin CY et al. Tissue Antigens 84:510-511 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (170 aa)
SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTL
RGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHAAEQQRAYLE
GRCVEWLRRX
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTACACCTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCAGGAGACACGGAATGTGAAGGCCCAGTCACAGACTGACCGAGTGGACCTGGGGACCC
TGCGCGGCTACTACAACCAGAGCGAGGACGGTTCTCACACCATCCAGATAATGTATGGCTGCGACGTGGGGCCGGACGGG
CGCTTCCTCCGCGGGTACCGGCAGGACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCTTGGAC
CGCGGCGGACATGGCAGCTCAGATCACCAAGCGCAAGTGGGAGGCGGCCCATGCGGCGGAGCAGCAGAGAGCCTACCTGG
AGGGCCGGTGCGTGGAGTGGCTCCGCAGATAACTGGAGAACGGGAAGGAGACGCTGCAGCGCACGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo