Allele Report for A*11:02:03

A*11:02:03 View HGVS Report
Pre-2010 Nomenclature: A*110203 Local Names: HLA-A
IMGT/HLA Acc No: HLA03247 OMIM Entry: *142800
Assigned: 2008-02-27 Sequence Last Modified: 2008-04-08
Source Entries: EU492459  
Cells Sequence Derived From: SZ-11  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Not defined
Publications
Li Z et al. Tissue Antigens 74:434-435 2009. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Unconfirmed
Cells: 1 Laboratories: 1
HLA Dictionary Data
Expert Assigned Type: A11 WHO Assigned Type: A11
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 1 A11 [99%]
NMDP (2008) 42 A11 [76%]
13 IHWC (2002) 8 A11
Neural Network Assigned Type: A11
Comments: ihw13:short A11 
Protein Sequence (298 aa)
MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGKPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEG
PEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAA
DMAAQITKRKWEAAHAAEQQRAYLEGRCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Nucleotide Sequence Data (895 bps)
ATGGCCGTCATGGCGCCCCGAACCCTCCTCCTGCTACTCTCGGGGGCCCTGGCCCTGACCCAGACCTGGGCGGGCTCCCA
CTCCATGAGGTATTTCTACACCTCCGTGTCCCGGCCCGGCCGCGGGAAGCCCCGCTTCATCGCCGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCAGGAGGGG
CCGGAGTATTGGGACCAGGAGACACGGAATGTGAAGGCCCAGTCACAGACTGACCGAGTGGACCTGGGGACCCTGCGCGG
CTACTACAACCAGAGCGAGGACGGTTCTCACACCATCCAGATAATGTATGGCTGCGACGTGGGGCCGGACGGGCGCTTCC
TCCGCGGGTACCGGCAGGACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCTTGGACCGCGGCG
GACATGGCAGCTCAGATCACCAAGCGCAAGTGGGAGGCGGCCCATGCGGCGGAGCAGCAGAGAGCCTACCTGGAGGGCCG
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGGACCCCCCCAAGACACATATGA
CCCACCACCCCATCTCTGACCATGAGGCCACTCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGGGAGGACCAGACCCAGGACACGGAGCTCGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAA
GTGGGCGGCTGTGGTGGTGCCTTCTGGAGAGGAGCAGAGATACACCTGCCATGTGCAGCATGAGGGTCTGCCCAAGCCCC
TCACCCTGAGATGGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo