Allele Report for A*03:05:01

A*03:05:01 View HGVS Report
Pre-2010 Nomenclature: A*0305 Local Names: A*0301V
IMGT/HLA Acc No: HLA01107 OMIM Entry: *142800
Assigned: 1999-11-17 Sequence Last Modified: 2000-10-08
Source Entries: AF135546 , AF135547 , AF173877 , AF173878 , AF190718 , AF190719 , AH007539 , AH008069 , AH008295 , AJ252283 , AJ252284 , AJ252285 , AJ401085 , AJ401086 , AJ401087  
Cells Sequence Derived From: 34507 , 99-2197 , CS , GN00262 , GN00309  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Common
Publications
Steiner NK et al. Tissue Antigens 56:551-2 2000. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 5 Laboratories: 4
HLA Dictionary Data
Expert Assigned Type: A3/blank WHO Assigned Type: A3
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) 5 Blank [100%]
13 IHWC (2002) 1 Blank
Neural Network Assigned Type: A3
Comments: ihw13: only reactive with some A3+11 and A3+19+34 sera; normal A3 
Protein Sequence (285 aa)
SGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKA
QSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEA
AHEAEQLRAYLEGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTE
LVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Nucleotide Sequence Data (858 bps)
TCTCGGGGGCCCTGGCCCTGACCCAGACCTGGGCGGGCTCCCACTCCATGAGGTATTTCTTCACATCCGTGTCCCGGCCC
GGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTACGTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAG
CCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCAGGAGGGGCCGGAGTATTGGGACCAGGAGACACGGAATGTGAAGG
CCCAGTCACAGACTGACCGAGTGGACCTGGGGACCCTGCGCGGCTACTACAACCAGAGCGAGGCCGGTTCTCACACCATC
CAGATAATGTATGGCTGCGACGTGGGGTCGGACGGGCGCTTCCTCCGCGGGTACCGGCAGGACGCCTACGACGGCAAGGA
TTACATCGCCCTGAACGAGGACCTGCGCTCTTGGACCGCGGCGGACATGGCGGCTCAGATCACCAAGCGCAAGTGGGAGG
CGGCCCATGAGGCGGAGCAGTTGAGAGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGG
AAGGAGACGCTGCAGCGCACGGACCCCCCCAAGACACATATGACCCACCACCCCATCTCTGACCATGAGGCCACCCTGAG
GTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGATGGGGAGGACCAGACCCAGGACACGG
AGCTCGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAAGTGGGCGGCTGTGGTGGTGCCTTCTGGAGAGGAGCAG
AGATACACCTGCCATGTGCAGCATGAGGGTCTGCCCAAGCCCCTCACCCTGAGATGGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo