Allele Report for A*03:01:14

A*03:01:14 View HGVS Report
Pre-2010 Nomenclature: A*030114 Local Names: HIS_NEW_A_179_00044, HIS_NEW_A_196_00121, HIS_NEW_A_197_00137, HIS_NEW_A_198_00139, DE HIS_NEW_A_198_00141, HIS_NEW_A_336_00498, HIS_NEW_A_475_00834, HIS_NEW_A_492_00865
IMGT/HLA Acc No: HLA03873 OMIM Entry: *142800
Assigned: 2009-05-31 Sequence Last Modified: 2010-01-15
Source Entries: FJ222573 , FJ224177 , FJ224193 , FJ224195 , FJ224197 , FJ619445 , FJ765901 , FJ976744 , FJ976868 , FN555233 , GQ160969 , GQ160996 , GQ161022 , GQ180290 , GQ180298 , GQ180307 , GQ180324 , GQ180335 , GQ180345 , GQ180346 , GQ199673 , GQ240356 , GQ240377 , GQ240380 , GQ240382 , GQ240541 , GQ401175 , GQ449621 , GQ449622 , GQ859512 , GQ994053  
Cells Sequence Derived From: 4VL071332 , HN-05098-4 , HN-16576-0 , HN-19428-2 , HN-22453-9 , HN-32569-1 , HN-33985-5 , HN-3461618 , HN-38246-8 , HN-40419-7 , HN-42295-8 , HN-42799-9 , HN-43533-9 , HN-44681-1 , HN-47828-5 , HN-48416-3 , HN-52525-8 , HN-52644-0 , HN-54806-8 , HN-58033-4 , HN-59324-6 , HN-70577-3 , HN-74235-3 , HN-79708-8 , HN-94231-6 , HN-B-174670 , HN-B-175317 , HN-B-175649 , HN-B-176247 , HN-B-181742 , HN-B-186904  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Jakubauskas A et al. Tissue Antigens 76:71-72 2010. (View abstract)
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 31 Laboratories: 2
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (298 aa)
MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEG
PEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAA
DMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Nucleotide Sequence Data (895 bps)
ATGGCCGTCATGGCGCCCCGAACCCTCCTCCTGCTACTCTCGGGGGCCCTGGCCCTGACCCAGACCTGGGCGGGCTCCCA
CTCCATGAGGTATTTCTTCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCAGGAGGGG
CCGGAGTATTGGGACCAGGAGACACGGAATGTGAAGGCCCAGTCACAGACTGACCGAGTGGACCTGGGGACCCTGCGCGG
CTACTACAACCAGAGCGAGGCCGGTTCTCACACCATCCAGATAATGTATGGCTGCGACGTGGGGTCGGACGGGCGCTTCC
TCCGCGGGTACCGGCAGGACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCTTGGACCGCGGCG
GACATGGCGGCTCAGATCACCAAGCGCAAGTGGGAGGCGGCCCATGAGGCAGAGCAGTTGAGAGCCTACCTGGATGGCAC
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGGACCCCCCCAAGACACATATGA
CCCACCACCCCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGGGAGGACCAGACCCAGGACACGGAGCTCGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAA
GTGGGCGGCTGTGGTGGTGCCTTCTGGAGAGGAGCAGAGATACACCTGCCATGTGCAGCATGAGGGTCTGCCCAAGCCCC
TCACCCTGAGATGGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo