Allele Report for A*03:01:05

A*03:01:05 View HGVS Report
Pre-2010 Nomenclature: A*030105 Local Names: A*0301MVE0406
IMGT/HLA Acc No: HLA02576 OMIM Entry: *142800
Assigned: 2006-05-31 Sequence Last Modified: 2006-07-14
Source Entries: AM261460 , GQ180278 , GQ240317  
Cells Sequence Derived From: HG00000369 , HN-83474-8 , Z-00023171  
Known Ethnic Origin Of Source: Unknown
CWD v2.0 Status: Not defined
Publications
Albis-Camps M et al. Tissue Antigens 71:85-6 2008. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: A3 WHO Assigned Type: A3
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 44 A3 [98-100%]
NMDP (2008) 3504 A3 [99%]
13 IHWC (2002) 106 A3
Neural Network Assigned Type: Training - A3
Comments:
Protein Sequence (181 aa)
SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTL
RGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLD
GTCVEWLRRYLENGKETLQRT
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTTCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCAGGAGACACGGAATGTGAAGGCCCAGTCACAGACTGACCGAGTGGACCTGGGGACCC
TGCGCGGCTACTACAACCAAAGCGAGGCCGGTTCTCACACCATCCAGATAATGTATGGCTGCGACGTGGGGTCGGACGGG
CGCTTCCTCCGCGGGTACCGGCAGGACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCTTGGAC
CGCGGCGGACATGGCGGCTCAGATCACCAAGCGCAAGTGGGAGGCGGCCCATGAGGCGGAGCAGTTGAGAGCCTACCTGG
ATGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo