Allele Report for A*03:01:01:01

A*03:01:01:01 View HGVS Report
Pre-2010 Nomenclature: A*03010101 Local Names: A*03011, A3.1, A*0301New
IMGT/HLA Acc No: HLA00037 OMIM Entry: *142800
Assigned: 1989-08-01 Sequence Last Modified: 1999-04-08
Source Entries: AB023056 , AL671277 , EU445472 , GQ924084 , GQ924085 , GU812296 , HG794390 , HG794396 , U32184 , X00492  
Cells Sequence Derived From: 7550800619 , AP630 , B9563 , CGM1 , JD , JG , NT01119 , NT01120 , PACO752792 , PGF , PP , RPCI5 , WILO05690  
Known Ethnic Origin Of Source: Black, Caucasoid, Oriental
CWD v2.0 Status: Common
Publications
Shiina T et al. Proc Natl Acad Sci U S A 96:13282-7 1999. (View abstract)
Strachan T et al. EMBO J 3:887-94 1984. (View abstract)
Tao H et al. Tissue Antigens 84:578-580 2014. (View abstract)
Zhu F et al. Int J Immunogenet 36:351-360 2009. (View abstract)
Stewart CA et al. Genome Res 14:1176-87 2004. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 13 Laboratories: 9
HLA Dictionary Data
Expert Assigned Type: A3 WHO Assigned Type: A3
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 44 A3 [98-100%]
NMDP (2008) 3504 A3 [99%]
13 IHWC (2002) 106 A3
Neural Network Assigned Type: Training - A3
Comments:
Protein Sequence (365 aa)
MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEG
PEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAA
DMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGA
VITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV
Nucleotide Sequence Data (1098 bps)
ATGGCCGTCATGGCGCCCCGAACCCTCCTCCTGCTACTCTCGGGGGCCCTGGCCCTGACCCAGACCTGGGCGGGCTCCCA
CTCCATGAGGTATTTCTTCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCAGGAGGGG
CCGGAGTATTGGGACCAGGAGACACGGAATGTGAAGGCCCAGTCACAGACTGACCGAGTGGACCTGGGGACCCTGCGCGG
CTACTACAACCAGAGCGAGGCCGGTTCTCACACCATCCAGATAATGTATGGCTGCGACGTGGGGTCGGACGGGCGCTTCC
TCCGCGGGTACCGGCAGGACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCTTGGACCGCGGCG
GACATGGCGGCTCAGATCACCAAGCGCAAGTGGGAGGCGGCCCATGAGGCGGAGCAGTTGAGAGCCTACCTGGATGGCAC
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGGACCCCCCCAAGACACATATGA
CCCACCACCCCATCTCTGACCATGAGGCCACCCTGAGGTGCTGGGCCCTGGGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGGGAGGACCAGACCCAGGACACGGAGCTCGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAA
GTGGGCGGCTGTGGTGGTGCCTTCTGGAGAGGAGCAGAGATACACCTGCCATGTGCAGCATGAGGGTCTGCCCAAGCCCC
TCACCCTGAGATGGGAGCTGTCTTCCCAGCCCACCATCCCCATCGTGGGCATCATTGCTGGCCTGGTTCTCCTTGGAGCT
GTGATCACTGGAGCTGTGGTCGCTGCCGTGATGTGGAGGAGGAAGAGCTCAGATAGAAAAGGAGGGAGTTACACTCAGGC
TGCAAGCAGTGACAGTGCCCAGGGCTCTGATGTGTCCCTCACAGCTTGTAAAGTGTGA
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo