Allele Report for A*02:36

A*02:36 View HGVS Report
Pre-2010 Nomenclature: A*0236 Local Names: A*02011V
IMGT/HLA Acc No: HLA01036 OMIM Entry: *142800
Assigned: 1999-07-13 Sequence Last Modified: 2014-01-17
Source Entries: AF157308 , AF157309 , AH008012 , HG003640 , HMO21759  
Cells Sequence Derived From: 5431200935 , GN00297 , NT01142  
Known Ethnic Origin Of Source: Oriental
CWD v2.0 Status: Well-Documented
Publications
Ellis J et al. Tissue Antigens 55:369-73 2000. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 3 Laboratories: 3
HLA Dictionary Data
Expert Assigned Type: A2 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) 1 A2 [100%]
13 IHWC (2002) - -
Neural Network Assigned Type: A2
Comments: Normal A2 
Protein Sequence (273 aa)
SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTL
RGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLE
GTCVDGLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTF
QKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRW
Nucleotide Sequence Data (822 bps)
GCTCTCACTCCATGAGGTATTTCTTCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGTCCGGAGTATTGGGACGGGGAGACACGGAAAGTGAAGGCCCACTCACAGACTCACCGAGTGGACCTGGGGACCC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGTTCTCACACCGTCCAGAGGATGTATGGCTGCGACGTGGGGTCGGACTGG
CGCTTCCTCCGCGGGTACCACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAAAGAGGACCTGCGCTCTTGGAC
CGCGGCGGACATGGCAGCTCAGACCACCAAGCACAAGTGGGAGGCGGCCCATGTGGCGGAGCAGTTGAGAGCCTACCTGG
AGGGCACGTGCGTGGACGGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGGACGCCCCCAAAACG
CATATGACTCACCACGCTGTCTCTGACCATGAAGCCACCCTGAGGTGCTGGGCCCTGAGCTTCTACCCTGCGGAGATCAC
ACTGACCTGGCAGCGGGATGGGGAGGACCAGACCCAGGACACGGAGCTCGTGGAGACCAGGCCTGCAGGGGATGGAACCT
TCCAGAAGTGGGCGGCTGTGGTGGTGCCTTCTGGACAGGAGCAGAGATACACCTGCCATGTGCAGCATGAGGGTTTGCCC
AAGCCCCTCACCCTGAGATGGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo