Allele Report for A*02:53N

A*02:53N View HGVS Report
Pre-2010 Nomenclature: A*0253N Local Names: HLA-A
IMGT/HLA Acc No: HLA01534 OMIM Entry: *142800
Assigned: 2001-10-31 Sequence Last Modified: 2002-01-11
Source Entries: AB233410 , AF416455 , AF479485 , AF479486 , AY310875 , AY310876 , GQ240530 , GQ240531  
Cells Sequence Derived From: CMC4 , HG00000587 , HN-0878046 , NS0657 , VTIS 25793 , Yanli  
Known Ethnic Origin Of Source: Oriental
Publications
Wu GG et al. Tissue Antigens 59:328-30 2002. (View abstract)
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 6 Laboratories: 5
HLA Dictionary Data
Expert Assigned Type: Not expressed WHO Assigned Type: Null
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) - -
Neural Network Assigned Type: Not tested
Comments:
Protein Sequence (108 aa)
MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEG
PEYWDGETRKVKAHSQTHRVDLGTLRGX
Nucleotide Sequence Data (1098 bps)
ATGGCCGTCATGGCGCCCCGAACCCTCGTCCTGCTACTCTCGGGGGCTCTGGCCCTGACCCAGACCTGGGCGGGCTCTCA
CTCCATGAGGTATTTCTTCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCAGGAGGGT
CCGGAGTATTGGGACGGGGAGACACGGAAAGTGAAGGCCCACTCACAGACTCACCGAGTGGACCTGGGGACCCTGCGCGG
CTAGTACAACCAGAGCGAGGCCGGTTCTCACACCGTCCAGAGGATGTATGGCTGCGACGTGGGGTCGGACTGGCGCTTCC
TCCGCGGGTACCACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAAAGAGGACCTGCGCTCTTGGACCGCGGCG
GACATGGCAGCTCAGACCACCAAGCACAAGTGGGAGGCGGCCCATGTGGCGGAGCAGTTGAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGGACGCCCCCAAAACGCATATGA
CTCACCACGCTGTCTCTGACCATGAAGCCACCCTGAGGTGCTGGGCCCTGAGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGGGAGGACCAGACCCAGGACACGGAGCTCGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAA
GTGGGCGGCTGTGGTGGTGCCTTCTGGACAGGAGCAGAGATACACCTGCCATGTGCAGCATGAGGGTTTGCCCAAGCCCC
TCACCCTGAGATGGGAGCCGTCTTCCCAGCCCACCATCCCCATCGTGGGCATCATTGCTGGCCTGGTTCTCTTTGGAGCT
GTGATCACTGGAGCTGTGGTCGCTGCTGTGATGTGGAGGAGGAAGAGCTCAGATAGAAAAGGAGGGAGCTACTCTCAGGC
TGCAAGCAGTGACAGTGCCCAGGGCTCTGATGTGTCTCTCACAGCTTGTAAAGTGTGA
Genomic Sequence Data (3305 bps)
CAGAAGCAGAGGGGTCAGGGCGAAGTCCCAGGGCCCCAGGCGTGGCTCTCAGGGTCTCAGGCCCCGAAGGCGGTGTATGG
ATTGGGGAGTCCCAGCCTTGGGGATTCCCCAACTCCGCAGTTTCTTTTCTCCCTCTCCCAACCTATGTAGGGTCCTTCTT
CCTGGATACTCACGACGCGGACCCAGTTCTCACTCCCATTGGGTGTCGGGTTTCCAGAGAAGCCAATCAGTGTCGTCGCG
GTCGCGGTTCTAAAGTCCGCACGCACCCACCGGGACTCAGATTCTCCCCAGACGCCGAGGATGGCCGTCATGGCGCCCCG
AACCCTCGTCCTGCTACTCTCGGGGGCTCTGGCCCTGACCCAGACCTGGGCGGGTGAGTGCGGGGTCGGGAGGGAAACGG
CCTCTGTGGGGAGAAGCAACGGGCCCGCCTGGCGGGGGCGCAGGACCCGGGAAGCCGCGCCGGGAGGAGGGTCGGGCGGG
TCTCAGCCACTCCTCGTCCCCAGGCTCTCACTCCATGAGGTATTTCTTCACATCCGTGTCCCGGCCCGGCCGCGGGGAGC
CCCGCTTCATCGCAGTGGGCTACGTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAG
CCGCGGGCGCCGTGGATAGAGCAGGAGGGTCCGGAGTATTGGGACGGGGAGACACGGAAAGTGAAGGCCCACTCACAGAC
TCACCGAGTGGACCTGGGGACCCTGCGCGGCTAGTACAACCAGAGCGAGGCCGGTGAGTGACCCCGGCCCGGGGCGCAGG
TCACGACCTCTCATCCCCCACGGACGGGCCAGGTCGCCCACAGTCTCCGGGTCCGAGATCCGCCCCGAAGCCGCGGGACC
CCGAGACCCTTGCCCCGGGAGAGGCCCAGGCGCCTTTACCCGGTTTCATTTTCAGTTTAGGCCAAAAATCCCCCCAGGTT
GGTCGGGGCGGGGCGGGGCTCGGGGGACCGGGCTGACCGCGGGGTCCGGGCCAGGTTCTCACACCGTCCAGAGGATGTAT
GGCTGCGACGTGGGGTCGGACTGGCGCTTCCTCCGCGGGTACCACCAGTACGCCTACGACGGCAAGGATTACATCGCCCT
GAAAGAGGACCTGCGCTCTTGGACCGCGGCGGACATGGCAGCTCAGACCACCAAGCACAAGTGGGAGGCGGCCCATGTGG
CGGAGCAGTTGAGAGCCTACCTGGAGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTG
CAGCGCACGGGTACCAGGGGCCACGGGGCGCCTCCCTGATCGCCTGTAGATCTCCCGGGCTGGCCTCCCACAAGGAGGGG
AGACAATTGGGACCAACACTAGAATATCGCCCTCCCTCTGGTCCTGAGGGAGAGGAATCCTCCTGGGTTTCCAGATCCTG
TACCAGAGAGTGACTCTGAGGTTCCGCCCTGCTCTCTGACACAATTAAGGGATAAAATCTCTGAAGGAATGACGGGAAGA
CGATCCCTCGAATACTGATGAGTGGTTCCCTTTGACACACACAGGCAGCAGCCTTGGGCCCGTGACTTTTCCTCTCAGGC
CTTGTTCTCTGCTTCACACTCAATGTGTGTGGGGGTCTGAGTCCAGCACTTCTGAGTCCTTCAGCCTCCACTCAGGTCAG
GACCAGAAGTCGCTGTTCCCTCTTCAGGGACTAGAATTTTCCACGGAATAGGAGATTATCCCAGGTGCCTGTGTCCAGGC
TGGTGTCTGGGTTCTGTGCTCCCTTCCCCATCCCAGGTGTCCTGTCCATTCTCAAGATAGCCACATGTGTGCTGGAGGAG
TGTCCCATGACAGATGCAAAATGCCTGAATGATCTGACTCTTCCTGACAGACGCCCCCAAAACGCATATGACTCACCACG
CTGTCTCTGACCATGAAGCCACCCTGAGGTGCTGGGCCCTGAGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGG
GATGGGGAGGACCAGACCCAGGACACGGAGCTCGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAAGTGGGCGGC
TGTGGTGGTGCCTTCTGGACAGGAGCAGAGATACACCTGCCATGTGCAGCATGAGGGTTTGCCCAAGCCCCTCACCCTGA
GATGGGGTAAGGAGGGAGACGGGGGTGTCATGTCTTTTAGGGAAAGCAGGAGCCTCTCTGACCTTTAGCAGGGTCAGGGC
CCCTCACCTTCCCCTCTTTTCCCAGAGCCGTCTTCCCAGCCCACCATCCCCATCGTGGGCATCATTGCTGGCCTGGTTCT
CTTTGGAGCTGTGATCACTGGAGCTGTGGTCGCTGCTGTGATGTGGAGGAGGAAGAGCTCAGGTGGGGAAGGGGTGAAGG
GTGGGTCTGAGATTTCTTGTCTCACTGAGGGTTCCAAGACCCAGGTAGAAGTGTGCCCTGCCTCGTTACTGGGAAGCACC
ACCCACAATTATGGGCCTACCCAGCCTGGGCCCTGTGTGCCAGCACTTACTCTTTTGTAAAGCACCTGTTAAAATGAAGG
ACAGATTTATCACCTTGATTACAGCGGTGATGGGACCTGATCCCAGCAGTCACAAGTCACAGGGGAAGGTCCCTGAGGAC
CTTCAGGAGGGCGGTTGGTCCAGGACCCACACCTGCTTTCTTCATGTTTCCTGATCCCGCCCTGGGTCTGCAGTCACACA
TTTCTGGAAACTTCTCTGAGGTCCAAGACTTGGAGGTTCCTCTAGGACCTTAAGGCCCTGACTCCTTTCTGGTATCTCAC
AGGACATTTTCTTCCCACAGATAGAAAAGGAGGGAGCTACTCTCAGGCTGCAAGTAAGTATGAAGGAGGCTGATGCCTGA
GGTCCTTGGGATATTGTGTTTGGGAGCCCATGGGGGAGCTCACCCACCCCACAATTCCTCCTCTAGCCACATCTTCTGTG
GGATCTGACCAGGTTCTGTTTTTGTTCTACCCCAGGCAGTGACAGTGCCCAGGGCTCTGATGTGTCTCTCACAGCTTGTA
AAGGTGAGAGCCTGGAGGGCCTGATGTGTGTTGGGTGTTGGGCGGAACAGTGGACACAGCTGTGCTATGGGGTTTCTTTC
CATTGGATGTATTGAGCATGCGATGGGCTGTTTAAAGTGTGACCCCTCACTGTGACAGATACGAATTTGTTCATGAATAT
TTTTTTCTATAGTGTGAGACAGCTGCCTTGTGTGGGACTGAGAGGCAAGAGTTGTTCCTGCCCTTCCCTTTGTGACTTGA
AGAACCCTGACTTTGTTTCTGCAAA

IMGT/HLA

Sponsors

Animated Sponsors Logo