Allele Report for A*02:05:02

A*02:05:02 View HGVS Report
Pre-2010 Nomenclature: A*020502 Local Names: HIS_NEW_A_193_00091
IMGT/HLA Acc No: HLA03656 OMIM Entry: *142800
Assigned: 2009-02-28 Sequence Last Modified: 2009-10-19
Source Entries: FJ224147 , FJ224159 , FJ224191 , FJ224238 , FJ619439 , FJ785202 , FJ785203 , FJ875537 , FJ952578 , FJ997931 , FJ997932 , FJ997933 , FJ997962 , GQ132041 , GQ180304 , GQ180321 , GQ240548 , GU947035 , HM004294 , HQ337723  
Cells Sequence Derived From: HG00000339 , HG00000340 , HG00000341 , HG00000342 , HG00000343 , HG00000344 , HG00000345 , HG00000346 , HN-02597-9 , HN-04903-3 , HN-35238-4 , HN-52933-5 , HN-55205-5 , HN-65045-3 , HN-68494-4 , HN-71835-0 , HN-78802-2 , HN-83850-2 , HN-85564-3 , HN-94313-4  
Known Ethnic Origin Of Source: Unknown
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 20 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASRRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTL
RGYYNQSEAGSHTLQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQWRAYLE
GTCVEWLRRYLENGKETLQRT
Nucleotide Sequence Data (546 bps)
GCTCTCACTCCATGAGGTATTTCTACACCTCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCGGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGTCCGGAGTATTGGGACGGGGAGACACGGAAAGTGAAGGCCCACTCACAGACTCACCGAGTGGACCTGGGGACCC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGTTCTCACACCCTCCAGAGGATGTATGGCTGCGACGTGGGGTCGGACTGG
CGCTTCCTGCGCGGGTACCACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAAAGAGGACCTGCGCTCTTGGAC
CGCGGCGGACATGGCAGCTCAGACCACCAAGCACAAGTGGGAGGCGGCCCATGTGGCGGAGCAGTGGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAAAACGGGAAGGAGACGCTGCAGCGCACGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo