Allele Report for A*02:01:23

A*02:01:23 View HGVS Report
Pre-2010 Nomenclature: A*020123 Local Names: HistoGenetics HIS_NEW_A_192_00085, HIS_NEW_A_194_00101, HIS_NEW_A_196_00118, DE HIS_NEW_A_226_00262, HIS_NEW_A_330_00449
IMGT/HLA Acc No: HLA03787 OMIM Entry: *142800
Assigned: 2009-04-30 Sequence Last Modified: 2009-10-19
Source Entries: FJ224141 , FJ224157 , FJ224174 , FJ224185 , FJ392155 , FJ600644 , FJ765931 , FJ785204 , FJ875542 , GQ149249 , GQ240539 , HM159279 , HM467445 , HQ226092 , HQ226106 , HQ590367 , HQ590369 , HQ590400 , HQ850025  
Cells Sequence Derived From: HG00000855 , HG00000856 , HG00000857 , HG00001177 , HG00001178 , HG00001179 , HG00001914 , HG00002377 , HN-00116-4 , HN-04209-3 , HN-06192-4 , HN-31306-3 , HN-32507-0 , HN-38885-6 , HN-43008-1 , HN-45398-1 , HN-50658-9 , HN-62729-8 , HN-77485-1  
Known Ethnic Origin Of Source: Unknown
Publications
Hernandez-Frederick CJ et al. Tissue Antigens 83:184-189 2014. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 19 Laboratories: 1
HLA Dictionary Data
Not currently included in the HLA Dictionary Data
Protein Sequence (181 aa)
SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTL
RGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLE
GTCVEWLRRYLENGKETLQRT
Nucleotide Sequence Data (546 bps)
GCTCTCACTCCATGAGGTATTTCTTCACATCCGTGTCTCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCAGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGTCCGGAGTATTGGGACGGGGAGACACGGAAAGTGAAGGCCCACTCACAGACTCACCGAGTGGACCTGGGGACCC
TGCGCGGCTACTACAACCAGAGCGAGGCCGGTTCTCACACCGTCCAGAGGATGTATGGCTGCGACGTGGGGTCGGACTGG
CGCTTCCTCCGCGGGTACCACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAAAGAGGACCTGCGCTCTTGGAC
CGCGGCGGACATGGCAGCTCAGACCACCAAGCACAAGTGGGAGGCGGCCCATGTGGCGGAGCAGTTGAGAGCCTACCTGG
AGGGCACGTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo