Allele Report for A*02:01:21

A*02:01:21 View HGVS Report
Pre-2010 Nomenclature: A*020121 Local Names: A*02new
IMGT/HLA Acc No: HLA03524 OMIM Entry: *142800
Assigned: 2008-10-24 Sequence Last Modified: 2016-07-14
Source Entries: FJ227107 , KX373268  
Alignment of CDS Source Entries
A*01:01:01:01
A*02:01:21
Submission 1
Submission 2

Locus Reference
  Virtual entry for A*02:01:21 
  Individual submission(s) 
Cells Sequence Derived From: CDC09282008 , NT01399  
Known Ethnic Origin Of Source: Caucasoid
CWD v2.0 Status: Not defined
ISO OID: 2.16.840.1.113883.13.252 (HL7 Registered Organisational OID)
2.16.840.1.113883.13.252.1.1.3524 (Allele OID)
Publications
Unpublished
Confirmatory Data
Sequence Status: Complete CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: A2 WHO Assigned Type: A2
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) 117 A2 [99-100%]
NMDP (2008) 6315 A2 [98%]
13 IHWC (2002) 230 A2
Neural Network Assigned Type: Training - A2
Comments:
Protein Sequence (365 aa)
MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEG
PEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAA
DMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGA
VITGAVVAAVMWRRKSSDRKGGSYSQAASSDSAQGSDVSLTACKV
Nucleotide Sequence Data (1098 bps)
ATGGCCGTCATGGCGCCCCGAACCCTCGTCCTGCTACTCTCGGGGGCTCTGGCCCTGACCCAGACCTGGGCGGGCTCTCA
CTCCATGAGGTATTTCTTCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCAGTGGGCTACGTGGACG
ACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCAGGAGGGT
CCGGAGTATTGGGACGGGGAGACACGGAAAGTGAAGGCCCACTCACAGACTCACCGAGTGGACCTGGGGACCCTGCGCGG
CTACTACAACCAGAGCGAGGCCGGTTCTCACACCGTCCAGAGGATGTATGGCTGCGACGTGGGGTCGGACTGGCGCTTCC
TCCGCGGGTACCACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAAAGAGGACCTGCGCTCTTGGACCGCGGCG
GACATGGCAGCTCAGACCACCAAGCACAAGTGGGAGGCGGCCCATGTGGCGGAGCAGTTGAGAGCCTACCTGGAGGGCAC
GTGCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGGACGCCCCCAAAACGCATATGA
CTCACCACGCTGTCTCTGACCATGAAGCCACTCTGAGGTGCTGGGCCCTGAGCTTCTACCCTGCGGAGATCACACTGACC
TGGCAGCGGGATGGGGAGGACCAGACCCAGGACACGGAGCTCGTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAA
GTGGGCGGCTGTGGTGGTGCCTTCTGGACAGGAGCAGAGATACACCTGCCATGTGCAGCATGAGGGTTTGCCCAAGCCCC
TCACCCTGAGATGGGAGCCGTCTTCCCAGCCCACCATCCCCATCGTGGGCATCATTGCTGGCCTGGTTCTCTTTGGAGCT
GTGATCACTGGAGCTGTGGTCGCTGCTGTGATGTGGAGGAGGAAGAGCTCAGATAGAAAAGGAGGGAGCTACTCTCAGGC
TGCAAGCAGTGACAGTGCCCAGGGCTCTGATGTGTCTCTCACAGCTTGTAAAGTGTGA
Genomic Sequence Data (3087 bps)
TCCCATTGGGTGTCGGGTTTCCAGAGAAGCCAATCAGTGTCGTCGCGGTCGCGGTTCTAAAGTCCGCACGCACCCACCGG
GACTCAGATTCTCCCCAGACGCCGAGGATGGCCGTCATGGCGCCCCGAACCCTCGTCCTGCTACTCTCGGGGGCTCTGGC
CCTGACCCAGACCTGGGCGGGTGAGTGCGGGGTCGGGAGGGAAACGGCCTCTGTGGGGAGAAGCAACGGGCCCGCCTGGC
GGGGGCGCAGGACCCGGGAAGCCGCGCCGGGAGGAGGGTCGGGCGGGTCTCAGCCACTCCTCGTCCCCAGGCTCTCACTC
CATGAGGTATTTCTTCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCAGTGGGCTACGTGGACGACA
CGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAGGATGGAGCCGCGGGCGCCGTGGATAGAGCAGGAGGGTCCG
GAGTATTGGGACGGGGAGACACGGAAAGTGAAGGCCCACTCACAGACTCACCGAGTGGACCTGGGGACCCTGCGCGGCTA
CTACAACCAGAGCGAGGCCGGTGAGTGACCCCGGCCCGGGGCGCAGGTCACGACCTCTCATCCCCCACGGACGGGCCAGG
TCGCCCACAGTCTCCGGGTCCGAGATCCGCCCCGAAGCCGCGGGACCCCGAGACCCTTGCCCCGGGAGAGGCCCAGGCGC
CTTTACCCGGTTTCATTTTCAGTTTAGGCCAAAAATCCCCCCAGGTTGGTCGGGGCGGGGCGGGGCTCGGGGGACCGGGC
TGACCGCGGGGTCCGGGCCAGGTTCTCACACCGTCCAGAGGATGTATGGCTGCGACGTGGGGTCGGACTGGCGCTTCCTC
CGCGGGTACCACCAGTACGCCTACGACGGCAAGGATTACATCGCCCTGAAAGAGGACCTGCGCTCTTGGACCGCGGCGGA
CATGGCAGCTCAGACCACCAAGCACAAGTGGGAGGCGGCCCATGTGGCGGAGCAGTTGAGAGCCTACCTGGAGGGCACGT
GCGTGGAGTGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGGGTACCAGGGGCCACGGGGCGCCT
CCCTGATCGCCTGTAGATCTCCCGGGCTGGCCTCCCACAAGGAGGGGAGACAATTGGGACCAACACTAGAATATCGCCCT
CCCTCTGGTCCTGAGGGAGAGGAATCCTCCTGGGTTTCCAGATCCTGTACCAGAGAGTGACTCTGAGGTTCCGCCCTGCT
CTCTGACACAATTAAGGGATAAAATCTCTGAAGGAATGACGGGAAGACGATCCCTCGAATACTGATGAGTGGTTCCCTTT
GACACACACAGGCAGCAGCCTTGGGCCCGTGACTTTTCCTCTCAGGCCTTGTTCTCTGCTTCACACTCAATGTGTGTGGG
GGTCTGAGTCCAGCACTTCTGAGTCCTTCAGCCTCCACTCAGGTCAGGACCAGAAGTCGCTGTTCCCTCTTCAGGGACTA
GAATTTTCCACGGAATAGGAGATTATCCCAGGTGCCTGTGTCCAGGCTGGTGTCTGGGTTCTGTGCTCCCTTCCCCATCC
CAGGTGTCCTGTCCATTCTCAAGATAGCCACATGTGTGCTGGAGGAGTGTCCCATGACAGATGCAAAATGCCTGAATGAT
CTGACTCTTCCTGACAGACGCCCCCAAAACGCATATGACTCACCACGCTGTCTCTGACCATGAAGCCACTCTGAGGTGCT
GGGCCCTGAGCTTCTACCCTGCGGAGATCACACTGACCTGGCAGCGGGATGGGGAGGACCAGACCCAGGACACGGAGCTC
GTGGAGACCAGGCCTGCAGGGGATGGAACCTTCCAGAAGTGGGCGGCTGTGGTGGTGCCTTCTGGACAGGAGCAGAGATA
CACCTGCCATGTGCAGCATGAGGGTTTGCCCAAGCCCCTCACCCTGAGATGGGGTAAGGAGGGAGACGGGGGTGTCATGT
CTTTTAGGGAAAGCAGGAGCCTCTCTGACCTTTAGCAGGGTCAGGGCCCCTCACCTTCCCCTCTTTTCCCAGAGCCGTCT
TCCCAGCCCACCATCCCCATCGTGGGCATCATTGCTGGCCTGGTTCTCTTTGGAGCTGTGATCACTGGAGCTGTGGTCGC
TGCTGTGATGTGGAGGAGGAAGAGCTCAGGTGGGGAAGGGGTGAAGGGTGGGTCTGAGATTTCTTGTCTCACTGAGGGTT
CCAAGACCCAGGTAGAAGTGTGCCCTGCCTCGTTACTGGGAAGCACCACCCACAATTATGGGCCTACCCAGCCTGGGCCC
TGTGTGCCAGCACTTACTCTTTTGTAAAGCACCTGTTAAAATGAAGGACAGATTTATCACCTTGATTACAGCGGTGATGG
GACCTGATCCCAGCAGTCACAAGTCACAGGGGAAGGTCCCTGAGGACCTTCAGGAGGGCGGTTGGTCCAGGACCCACACC
TGCTTTCTTCATGTTTCCTGATCCCGCCCTGGGTCTGCAGTCACACATTTCTGGAAACTTCTCTGAGGTCCAAGACTTGG
AGGTTCCTCTAGGACCTTAAGGCCCTGACTCCTTTCTGGTATCTCACAGGACATTTTCTTCCCACAGATAGAAAAGGAGG
GAGCTACTCTCAGGCTGCAAGTAAGTATGAAGGAGGCTGATGCCTGAGGTCCTTGGGATATTGTGTTTGGGAGCCCATGG
GGGAGCTCACCCACCCCACAATTCCTCCTCTAGCCACATCTTCTGTGGGATCTGACCAGGTTCTGTTTTTGTTCTACCCC
AGGCAGTGACAGTGCCCAGGGCTCTGATGTGTCTCTCACAGCTTGTAAAGGTGAGAGCCTGGAGGGCCTGATGTGTGTTG
GGTGTTGGGCGGAACAGTGGACACAGCTGTGCTATGGGGTTTCTTTCCATTGGATGTATTGAGCATGCGATGGGCTGTTT
AAAGTGTGACCCCTCACTGTGACAGATACGAATTTGTTCATGAATATTTTTTTCTATAGTGTGAGACAGCTGCCTTGTGT
GGGACTGAGAGGCAAGAGTTGTTCCTGCCCTTCCCTTTGTGACTTGA

IPD-IMGT/HLA

Sponsors