Allele Report for A*01:26

A*01:26 View HGVS Report
Pre-2010 Nomenclature: A*0126 Local Names: BY00162
IMGT/HLA Acc No: HLA02920 OMIM Entry: *142800
Assigned: 2007-04-30 Sequence Last Modified: 2007-07-09
Source Entries: EF536018 , EF591033 , FJ594680  
Cells Sequence Derived From: BY00162 , NT00736  
Known Ethnic Origin Of Source: Caucasoid
Publications
Lazaro AM et al. Tissue Antigens 73:364-72 2009. (View abstract)
Confirmatory Data
Sequence Status: Partial CDS Confirmed: Confirmed
Cells: 2 Laboratories: 2
HLA Dictionary Data
Expert Assigned Type: A1 WHO Assigned Type: -
Tested by: No. Cells Tested: Assigned Type:
International Cell Exchange UCLA (2008) - -
NMDP (2008) - -
13 IHWC (2002) - -
Neural Network Assigned Type: A1
Comments:
Protein Sequence (181 aa)
SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTL
RGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHAAEQRRVYLE
GRCVDGLRRYLENGKETLQRT
Nucleotide Sequence Data (546 bps)
GCTCCCACTCCATGAGGTATTTCTTCACATCCGTGTCCCGGCCCGGCCGCGGGGAGCCCCGCTTCATCGCCGTGGGCTAC
GTGGACGACACGCAGTTCGTGCGGTTCGACAGCGACGCCGCGAGCCAGAAGATGGAGCCGCGGGCGCCGTGGATAGAGCA
GGAGGGGCCGGAGTATTGGGACCAGGAGACACGGAATATGAAGGCCCACTCACAGACTGACCGAGCGAACCTGGGGACCC
TGCGCGGCTACTACAACCAGAGCGAGGACGGTTCTCACACCATCCAGATAATGTATGGCTGCGACGTGGGGCCGGACGGG
CGCTTCCTCCGCGGGTACCGGCAGGACGCCTACGACGGCAAGGATTACATCGCCCTGAACGAGGACCTGCGCTCTTGGAC
CGCGGCGGACATGGCAGCTCAGATCACCAAGCGCAAGTGGGAGGCGGCCCATGCGGCGGAGCAGCGGAGAGTCTACCTGG
AGGGCCGGTGCGTGGACGGGCTCCGCAGATACCTGGAGAACGGGAAGGAGACGCTGCAGCGCACGG
Genomic Sequence Data (0 bps)
Not Currently Available

IMGT/HLA

Sponsors

Animated Sponsors Logo